Recombinant Human ABCA4 Protein, GST-Tagged

Cat.No. : ABCA4-033H
Product Overview : Human ABCA4 partial ORF ( NP_000341, 2174 a.a. - 2273 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This protein is a retina-specific ABC transporter with N-retinylidene-PE as a substrate. It is expressed exclusively in retina photoreceptor cells, indicating the gene product mediates transport of an essental molecule across the photoreceptor cell membrane. Mutations in this gene are found in patients diagnosed with Stargardt disease, a form of juvenile-onset macular degeneration. Mutations in this gene are also associated with retinitis pigmentosa-19, cone-rod dystrophy type 3, early-onset severe retinal dystrophy, fundus flavimaculatus, and macular degeneration age-related 2. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : PKDDLLPDLNPVEQFFQGNFPGSVQRERHYNMLQFQVSSSSLARIFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFAKQQTESHDLPLHPRAAGASRQAQD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCA4 ATP-binding cassette, sub-family A (ABC1), member 4 [ Homo sapiens ]
Official Symbol ABCA4
Synonyms ABCA4; ATP-binding cassette, sub-family A (ABC1), member 4; ABCR, ATP binding cassette transporter, retinal specific , RP19, STGD, STGD1; retinal-specific ATP-binding cassette transporter; ARMD2; FFM; Stargardt disease; RIM protein; RIM ABC transporter; photoreceptor rim protein; stargardt disease protein; retina-specific ABC transporter; ATP binding cassette transporter; ATP-binding transporter, retina-specific; ATP-binding cassette sub-family A member 4; ATP-binding cassette transporter, retinal-specific; RMP; ABCR; RP19; STGD; ABC10; CORD3; STGD1; FLJ17534; DKFZp781N1972;
Gene ID 24
mRNA Refseq NM_000350
Protein Refseq NP_000341
MIM 601691
UniProt ID P78363

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCA4 Products

Required fields are marked with *

My Review for All ABCA4 Products

Required fields are marked with *

0
cart-icon
0
compare icon