Recombinant Human ABCB1, His-tagged
Cat.No. : | ABCB1-30530TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1036-1280 of Human P Glycoprotein with N terminal His tag; Predicted MWt 28 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1036-1280 a.a. |
Description : | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. |
Conjugation : | HIS |
Tissue specificity : | Expressed in liver, kidney, small intestine and brain. |
Form : | Lyophilised:Reconstitute with 37 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCG KSTVVQLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHL GIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAKE ANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARA LVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIV IAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIY FSMVSVQAGTKRQ |
Sequence Similarities : | Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.Contains 2 ABC transmembrane type-1 domains.Contains 2 ABC transporter domains. |
Gene Name | ABCB1 ATP-binding cassette, sub-family B (MDR/TAP), member 1 [ Homo sapiens ] |
Official Symbol | ABCB1 |
Synonyms | ABCB1; ATP-binding cassette, sub-family B (MDR/TAP), member 1; CLCS, colchicin sensitivity , MDR1, PGY1; multidrug resistance protein 1; ABC20; CD243; GP170; P gp; |
Gene ID | 5243 |
mRNA Refseq | NM_000927 |
Protein Refseq | NP_000918 |
MIM | 171050 |
Uniprot ID | P08183 |
Chromosome Location | 7q21.12 |
Pathway | ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; |
Function | ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; hydrolase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
ABCB1-259C | Recombinant Cynomolgus ABCB1 Protein, His-tagged | +Inquiry |
ABCB1-2132H | Recombinant Human ABCB1 protein(350-710aa), His-tagged | +Inquiry |
ABCB1-1360H | Recombinant Human ABCB1 Protein (Phe394-Val672), N-GST tagged | +Inquiry |
ABCB1-9C | Recombinant Cynomolgus Monkey ABCB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCB1-6R | Recombinant Rhesus Macaque ABCB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ABCB1-10H | Recombinant Human TMPRSS3 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCB1 Products
Required fields are marked with *
My Review for All ABCB1 Products
Required fields are marked with *
0
Inquiry Basket