Recombinant Human ABCB7, GST-tagged
Cat.No. : | ABCB7-23H |
Product Overview : | Recombinant Human ABCB7(39 a.a. - 753 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a half-transporter involved in the transport of heme from the mitochondria to the cytosol. With iron/sulfur cluster precursors as its substrates, this protein may play a role in metal homeostasis. Mutations in this gene have been associated with mitochondrial iron accumulation and isodicentric (X)(q13) and sideroblastic anemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Molecular Mass : | 104.39 kDa |
AA Sequence : | PQWRPHQLGALGTARAYQQIPESLKSITWQRLGKGNSGQFLDAAKALQVWPLIEKRTCWHGHAGGGLHTDPKEGL KDVDTRKIIKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSDAPNTVAT MATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISF VLSALVFNLLPIMFEVMLVSGVLYYKCGAQFALVTLGTLGTYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSL LNYETVKYFNNERYEAQRYDGFLKTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVLASQGIVAGTLTVGDLVM VNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLKVDTQIKDKVMASPLQITPQTATVAFDNVHFEYIEGQKV LSGISFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVSLESLRRAVGVVPQDAVLFHNTI YYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATS SLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRV QNHDNPKWEAKKENISKEEERKKLQEEIVNSVKGCGNCSC |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 [ Homo sapiens ] |
Official Symbol | ABCB7 |
Synonyms | ABCB7; ATP-binding cassette, sub-family B (MDR/TAP), member 7; ABC7; ATP-binding cassette sub-family B member 7, mitochondrial; ASAT; Atm1p; EST140535 |
Gene ID | 22 |
mRNA Refseq | NM_004299 |
Protein Refseq | NP_004290 |
MIM | 300135 |
UniProt ID | O75027 |
Chromosome Location | Xq13.3 |
Pathway | ABC transporters; ABC-family proteins mediated transport; Cytosolic iron-sulfur cluster assembly |
Function | ATP binding; ATPase activity, coupled to transmembrane movement of substances; heme transporter activity |
◆ Recombinant Proteins | ||
ABCB7-01HF | Recombinant Full Length Human ABCB7 Protein | +Inquiry |
ABCB7-32H | Recombinant Human ABCB7 Protein, N-His-tagged | +Inquiry |
ABCB7-23H | Recombinant Human ABCB7, GST-tagged | +Inquiry |
RFL31907RF | Recombinant Full Length Rat Atp-Binding Cassette Sub-Family B Member 7, Mitochondrial(Abcb7) Protein, Tag-Free | +Inquiry |
ABCB7-399R | Recombinant Rat ABCB7 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCB7 Products
Required fields are marked with *
My Review for All ABCB7 Products
Required fields are marked with *
0
Inquiry Basket