Recombinant Human ABCC2 Protein, GST-Tagged
Cat.No. : | ABCC2-047H |
Product Overview : | Human ABCC2 partial ORF ( NP_000383, 214 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABCC2 ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [ Homo sapiens ] |
Official Symbol | ABCC2 |
Synonyms | ABCC2; ATP-binding cassette, sub-family C (CFTR/MRP), member 2; canalicular multispecific organic anion transporter 1 , CMOAT; canalicular multispecific organic anion transporter 1; cMRP; DJS; MRP2; canalicular multidrug resistance protein; multidrug resistance-associated protein 2; ATP-binding cassette sub-family C member 2; ABC30; CMOAT; |
Gene ID | 1244 |
mRNA Refseq | NM_000392 |
Protein Refseq | NP_000383 |
MIM | 601107 |
UniProt ID | Q92887 |
◆ Recombinant Proteins | ||
MRP2 Vesicles-02R | Rat MRP2 Vesicles, ABC transporter vesicles | +Inquiry |
Abcc2-2538R | Recombinant Rat Abcc2 | +Inquiry |
ABCC2-1100M | Recombinant Mouse ABCC2 Protein | +Inquiry |
RFL31491AF | Recombinant Full Length Arabidopsis Thaliana Abc Transporter D Family Member 2, Chloroplastic(Abcc2) Protein, His-Tagged | +Inquiry |
ABCC2-11C | Recombinant Cynomolgus Monkey ABCC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC2 Products
Required fields are marked with *
My Review for All ABCC2 Products
Required fields are marked with *