Recombinant Human ABCC2 Protein, GST-Tagged

Cat.No. : ABCC2-047H
Product Overview : Human ABCC2 partial ORF ( NP_000383, 214 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCC2 ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [ Homo sapiens ]
Official Symbol ABCC2
Synonyms ABCC2; ATP-binding cassette, sub-family C (CFTR/MRP), member 2; canalicular multispecific organic anion transporter 1 , CMOAT; canalicular multispecific organic anion transporter 1; cMRP; DJS; MRP2; canalicular multidrug resistance protein; multidrug resistance-associated protein 2; ATP-binding cassette sub-family C member 2; ABC30; CMOAT;
Gene ID 1244
mRNA Refseq NM_000392
Protein Refseq NP_000383
MIM 601107
UniProt ID Q92887

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCC2 Products

Required fields are marked with *

My Review for All ABCC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon