Recombinant Human ABCC2 protein, GST-tagged
Cat.No. : | ABCC2-3433H |
Product Overview : | Recombinant Human ABCC2 protein(1470-1545 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1470-1545 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | ETDNLIQTTIQNEFAHCTVITIAHRLHTIMDSDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF |
Gene Name | ABCC2 ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [ Homo sapiens ] |
Official Symbol | ABCC2 |
Synonyms | ABCC2; ATP-binding cassette, sub-family C (CFTR/MRP), member 2; canalicular multispecific organic anion transporter 1 , CMOAT; canalicular multispecific organic anion transporter 1; cMRP; DJS; MRP2; canalicular multidrug resistance protein; multidrug resistance-associated protein 2; ATP-binding cassette sub-family C member 2; ABC30; CMOAT; |
Gene ID | 1244 |
mRNA Refseq | NM_000392 |
Protein Refseq | NP_000383 |
MIM | 601107 |
UniProt ID | Q92887 |
◆ Recombinant Proteins | ||
ABCC2-180R | Recombinant Rhesus monkey ABCC2 Protein, His-tagged | +Inquiry |
MRP2 Vesicles-01H | Human MRP2 Vesicles, ABC transporter vesicles | +Inquiry |
ABCC2-1100M | Recombinant Mouse ABCC2 Protein | +Inquiry |
MRP2 Vesicles-02R | Rat MRP2 Vesicles, ABC transporter vesicles | +Inquiry |
ABCC2-3433H | Recombinant Human ABCC2 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC2 Products
Required fields are marked with *
My Review for All ABCC2 Products
Required fields are marked with *
0
Inquiry Basket