Recombinant Human ABCC3 protein, His-tagged
| Cat.No. : | ABCC3-5343H |
| Product Overview : | Recombinant Human ABCC3 protein(838-960 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 838-960 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | LLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFW |
| Gene Name | ABCC3 ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [ Homo sapiens ] |
| Official Symbol | ABCC3 |
| Synonyms | ABCC3; ATP-binding cassette, sub-family C (CFTR/MRP), member 3; canalicular multispecific organic anion transporter 2; cMOAT2; EST90757; MLP2; MOAT D; MRP3; multidrug resistance associated protein; multidrug resistance-associated protein 3; ATP-binding cassette sub-family C member 3; multi-specific organic anion transporter D; canicular multispecific organic anion transporter; ABC31; MOAT-D; |
| Gene ID | 8714 |
| mRNA Refseq | NM_001144070 |
| Protein Refseq | NP_001137542 |
| MIM | 604323 |
| UniProt ID | O15438 |
| ◆ Recombinant Proteins | ||
| ABCC3-1101M | Recombinant Mouse ABCC3 Protein | +Inquiry |
| ABCC3-198M | Recombinant Mouse ABCC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HRAS-13934H | Recombinant Human HRAS protein, His-tagged | +Inquiry |
| ABCC3-8118H | Recombinant Human ABCC3 protein, His & T7-tagged | +Inquiry |
| ABCC3-60R | Recombinant Rat ABCC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABCC3-9150HCL | Recombinant Human ABCC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC3 Products
Required fields are marked with *
My Review for All ABCC3 Products
Required fields are marked with *
