Recombinant Human ABCC3 protein, His-tagged
Cat.No. : | ABCC3-5343H |
Product Overview : | Recombinant Human ABCC3 protein(838-960 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 838-960 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | LLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFW |
Gene Name | ABCC3 ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [ Homo sapiens ] |
Official Symbol | ABCC3 |
Synonyms | ABCC3; ATP-binding cassette, sub-family C (CFTR/MRP), member 3; canalicular multispecific organic anion transporter 2; cMOAT2; EST90757; MLP2; MOAT D; MRP3; multidrug resistance associated protein; multidrug resistance-associated protein 3; ATP-binding cassette sub-family C member 3; multi-specific organic anion transporter D; canicular multispecific organic anion transporter; ABC31; MOAT-D; |
Gene ID | 8714 |
mRNA Refseq | NM_001144070 |
Protein Refseq | NP_001137542 |
MIM | 604323 |
UniProt ID | O15438 |
◆ Recombinant Proteins | ||
Adprh-2064M | Recombinant Mouse ADP-ribosylarginine Hydrolase, His-tagged | +Inquiry |
Adprh-547M | Recombinant Mouse Adprh Protein, MYC/DDK-tagged | +Inquiry |
ADPRH-2063H | Recombinant Human ADP-ribosylarginine Hydrolase, His-tagged | +Inquiry |
ADPRH-973HF | Recombinant Full Length Human ADPRH Protein, GST-tagged | +Inquiry |
ADPRH-359M | Recombinant Mouse ADPRH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADPRH-9003HCL | Recombinant Human ADPRH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADPRH Products
Required fields are marked with *
My Review for All ADPRH Products
Required fields are marked with *
0
Inquiry Basket