Recombinant Human ACAD10 protein, His-tagged
Cat.No. : | ACAD10-4756H |
Product Overview : | Recombinant Human ACAD10 protein(1-237 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-237 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEITAEGFLREFGRLCSEMLKTSVPVDSFFSLLTSERVAKQFPVMTEAITQIRAKGLQTAVLSNNFYLPNQKSFLPLDRKQFDVIVESCMEGICKPDPRIYKLCLEQLGLQPSESIFLDDLGTNLKEAARLGIHTIKVNDPETAVKELEALLGFTLRVGVPNTRPVKKTMEIPKDSLQKYLKDLLGIQTTGL |
Gene Name | ACAD10 acyl-CoA dehydrogenase family, member 10 [ Homo sapiens ] |
Official Symbol | ACAD10 |
Synonyms | ACAD10; acyl-CoA dehydrogenase family, member 10; acyl Coenzyme A dehydrogenase family, member 10; acyl-CoA dehydrogenase family member 10; MGC5601; ACAD-10; acyl-Coenzyme A dehydrogenase family, member 10; |
Gene ID | 80724 |
mRNA Refseq | NM_001136538 |
Protein Refseq | NP_001130010 |
MIM | 611181 |
UniProt ID | Q6JQN1 |
◆ Recombinant Proteins | ||
ACAD10-892HF | Recombinant Full Length Human ACAD10 Protein, GST-tagged | +Inquiry |
ACAD10-1157M | Recombinant Mouse ACAD10 Protein | +Inquiry |
ACAD10-4756H | Recombinant Human ACAD10 protein, His-tagged | +Inquiry |
ACAD10-9263H | Recombinant Human ACAD10, GST-tagged | +Inquiry |
ACAD10-128H | Recombinant Human ACAD10 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAD10-14HCL | Recombinant Human ACAD10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACAD10 Products
Required fields are marked with *
My Review for All ACAD10 Products
Required fields are marked with *