Recombinant Human ADAMTSL3 protein, GST-tagged
Cat.No. : | ADAMTSL3-3672H |
Product Overview : | Recombinant Human ADAMTSL3 protein(616-720 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | August 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 616-720 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | TERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATCLGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSWGPCSATCG |
Gene Name | ADAMTSL3 ADAMTS-like 3 [ Homo sapiens ] |
Official Symbol | ADAMTSL3 |
Synonyms | ADAMTSL3; ADAMTS-like 3; ADAMTS-like protein 3; KIAA1233; punctin 2; ADAMTSL-3; punctin-2; a disintegrin-like and metalloprotease domain with thrombospondin type I motifs-like 3; MGC150716; MGC150717; |
Gene ID | 57188 |
mRNA Refseq | NM_207517 |
Protein Refseq | NP_997400 |
MIM | 609199 |
UniProt ID | P82987 |
◆ Recombinant Proteins | ||
ADAMTSL3-3672H | Recombinant Human ADAMTSL3 protein, GST-tagged | +Inquiry |
ACAD10-9263H | Recombinant Human ACAD10, GST-tagged | +Inquiry |
ACAD10-128H | Recombinant Human ACAD10 Protein, GST-Tagged | +Inquiry |
ACAD10-892HF | Recombinant Full Length Human ACAD10 Protein, GST-tagged | +Inquiry |
ACAD10-233M | Recombinant Mouse ACAD10 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAD10-14HCL | Recombinant Human ACAD10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACAD10 Products
Required fields are marked with *
My Review for All ACAD10 Products
Required fields are marked with *