Recombinant Human ADAMTSL3 protein, GST-tagged
| Cat.No. : | ADAMTSL3-3672H |
| Product Overview : | Recombinant Human ADAMTSL3 protein(616-720 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | September 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 616-720 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | TERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATCLGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSWGPCSATCG |
| Gene Name | ADAMTSL3 ADAMTS-like 3 [ Homo sapiens ] |
| Official Symbol | ADAMTSL3 |
| Synonyms | ADAMTSL3; ADAMTS-like 3; ADAMTS-like protein 3; KIAA1233; punctin 2; ADAMTSL-3; punctin-2; a disintegrin-like and metalloprotease domain with thrombospondin type I motifs-like 3; MGC150716; MGC150717; |
| Gene ID | 57188 |
| mRNA Refseq | NM_207517 |
| Protein Refseq | NP_997400 |
| MIM | 609199 |
| UniProt ID | P82987 |
| ◆ Recombinant Proteins | ||
| ACAD10-128H | Recombinant Human ACAD10 Protein, GST-Tagged | +Inquiry |
| ACAD10-4756H | Recombinant Human ACAD10 protein, His-tagged | +Inquiry |
| ACAD10-892HF | Recombinant Full Length Human ACAD10 Protein, GST-tagged | +Inquiry |
| ADAMTSL3-3672H | Recombinant Human ADAMTSL3 protein, GST-tagged | +Inquiry |
| ACAD10-233M | Recombinant Mouse ACAD10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACAD10-14HCL | Recombinant Human ACAD10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACAD10 Products
Required fields are marked with *
My Review for All ACAD10 Products
Required fields are marked with *
