Recombinant Human ACAT2 protein, T7-tagged
Cat.No. : | ACAT2-166H |
Product Overview : | Recombinant human ACAT2 fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFGSNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGH VLAAGCGQNPVRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGMENMSKAPHLAYLRTG VKIGEMPLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVST RKGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARIVSWS QVGVEPSIMGIGPIPAIKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIALGHPLGASG CRILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRE |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for cell lipid metabolic pathway regulation study in vitro using recombinant ACAT2 protein intracellular delivery methods.2. May be used for in vitro protein–protein interaction measurement for mapping ACAT2 binder.3. Excellent lysine acetylation subtract protein for enzymatic assay development.4. May be used as antigen for specific antibody development. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | ACAT2 acetyl-CoA acetyltransferase 2 [ Homo sapiens ] |
Official Symbol | ACAT2 |
Synonyms | ACAT2; acetyl-CoA acetyltransferase 2; acetyl Coenzyme A acetyltransferase 2 , acetyl Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase); acetyl-CoA acetyltransferase, cytosolic; acetoacetyl Coenzyme A thiolase; cytosolic acetoacetyl-CoA thiolase; acetyl-CoA transferase-like protein; |
Gene ID | 39 |
mRNA Refseq | NM_005891 |
Protein Refseq | NP_005882 |
MIM | 100678 |
UniProt ID | Q9BWD1 |
Chromosome Location | 6q25.3-q26 |
Pathway | Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, organism-specific biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, conserved biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Fatty acid metabolism, organism-specific biosystem; |
Function | acetyl-CoA C-acetyltransferase activity; transferase activity, transferring acyl groups other than amino-acyl groups; |
◆ Recombinant Proteins | ||
ACAT2-26052TH | Recombinant Human ACAT2, T7 -tagged | +Inquiry |
ACAT2-8947Z | Recombinant Zebrafish ACAT2 | +Inquiry |
ACAT2-166H | Recombinant Human ACAT2 protein, T7-tagged | +Inquiry |
ACAT2-4673H | Recombinant Human ACAT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACAT2-0178H | Recombinant Human ACAT2 Protein (Met1-Glu397), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAT2-9108HCL | Recombinant Human ACAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACAT2 Products
Required fields are marked with *
My Review for All ACAT2 Products
Required fields are marked with *