Recombinant Human ACAT2 protein, T7-tagged

Cat.No. : ACAT2-166H
Product Overview : Recombinant human ACAT2 fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFGSNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGH VLAAGCGQNPVRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGMENMSKAPHLAYLRTG VKIGEMPLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVST RKGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARIVSWS QVGVEPSIMGIGPIPAIKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIALGHPLGASG CRILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRE
Purity : >90% by SDS-PAGE
Applications : 1. May be used for cell lipid metabolic pathway regulation study in vitro using recombinant ACAT2 protein intracellular delivery methods.2. May be used for in vitro protein–protein interaction measurement for mapping ACAT2 binder.3. Excellent lysine acetylation subtract protein for enzymatic assay development.4. May be used as antigen for specific antibody development.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name ACAT2 acetyl-CoA acetyltransferase 2 [ Homo sapiens ]
Official Symbol ACAT2
Synonyms ACAT2; acetyl-CoA acetyltransferase 2; acetyl Coenzyme A acetyltransferase 2 , acetyl Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase); acetyl-CoA acetyltransferase, cytosolic; acetoacetyl Coenzyme A thiolase; cytosolic acetoacetyl-CoA thiolase; acetyl-CoA transferase-like protein;
Gene ID 39
mRNA Refseq NM_005891
Protein Refseq NP_005882
MIM 100678
UniProt ID Q9BWD1
Chromosome Location 6q25.3-q26
Pathway Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, organism-specific biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, conserved biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Fatty acid metabolism, organism-specific biosystem;
Function acetyl-CoA C-acetyltransferase activity; transferase activity, transferring acyl groups other than amino-acyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACAT2 Products

Required fields are marked with *

My Review for All ACAT2 Products

Required fields are marked with *

0
cart-icon