"ACAT2" Related Products

Expand
Expand
Expand

Recombinant Human ACAT2 protein, T7-tagged

Cat.No.: ACAT2-166H
Product Overview: Recombinant human ACAT2 fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFGSNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGH VLAAGCGQNPVRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGMENMSKAPHLAYLRTG VKIGEMPLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVST RKGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARIVSWS QVGVEPSIMGIGPIPAIKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIALGHPLGASG CRILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRE
Purity: >90% by SDS-PAGE
Applications: 1. May be used for cell lipid metabolic pathway regulation study in vitro using recombinant ACAT2 protein intracellular delivery methods.2. May be used for in vitro protein–protein interaction measurement for mapping ACAT2 binder.3. Excellent lysine acetylation subtract protein for enzymatic assay development.4. May be used as antigen for specific antibody development.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: ACAT2 acetyl-CoA acetyltransferase 2 [ Homo sapiens ]
Official Symbol: ACAT2
Synonyms: ACAT2; acetyl-CoA acetyltransferase 2; acetyl Coenzyme A acetyltransferase 2 , acetyl Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase); acetyl-CoA acetyltransferase, cytosolic; acetoacetyl Coenzyme A thiolase; cytosolic acetoacetyl-CoA thiolase; acetyl-CoA transferase-like protein;
Gene ID: 39
mRNA Refseq: NM_005891
Protein Refseq: NP_005882
MIM: 100678
UniProt ID: Q9BWD1
Chromosome Location: 6q25.3-q26
Pathway: Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, organism-specific biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, conserved biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Fatty acid metabolism, organism-specific biosystem;
Function: acetyl-CoA C-acetyltransferase activity; transferase activity, transferring acyl groups other than amino-acyl groups;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.