Recombinant Human ACE2 protein, His-tagged
| Cat.No. : | ACE2-2452H |
| Product Overview : | Recombinant Human ACE2 protein(392-744 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 392-744 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ACE2 angiotensin I converting enzyme (peptidyl-dipeptidase A) 2 [ Homo sapiens ] |
| Official Symbol | ACE2 |
| Synonyms | ACE2; angiotensin I converting enzyme (peptidyl-dipeptidase A) 2; angiotensin-converting enzyme 2; metalloprotease MPROT15; ACE-related carboxypeptidase; angiotensin I converting enzyme 2; angiotensin-converting enzyme homolog; ACEH; |
| Gene ID | 59272 |
| mRNA Refseq | NM_021804 |
| Protein Refseq | NP_068576 |
| MIM | 300335 |
| UniProt ID | Q9BYF1 |
| ◆ Recombinant Proteins | ||
| Ace2-1194R | Active Recombinant Rat Ace2 protein(Met1-Thr740), His-tagged | +Inquiry |
| ACE2-2881H | Recombinant Human ACE2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| ACE2-092H | Recombinant Human ACE2 protein, hFc-tagged | +Inquiry |
| ACE2-0048H | Recombinant Human ACE2 Protein | +Inquiry |
| ACE2-37R | Recombinant Rhesus Macaque ACE2 Protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACE2-2085MCL | Recombinant Mouse ACE2 cell lysate | +Inquiry |
| ACE2-887CCL | Recombinant Cynomolgus ACE2 cell lysate | +Inquiry |
| ACE2-3100HCL | Recombinant Human ACE2 cell lysate | +Inquiry |
| ACE2-1851RCL | Recombinant Rat ACE2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACE2 Products
Required fields are marked with *
My Review for All ACE2 Products
Required fields are marked with *
