Recombinant Human ACER2 protein, His-tagged
Cat.No. : | ACER2-3262H |
Product Overview : | Recombinant Human ACER2 protein(1-100 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-100 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MGAPHWWDQLQAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFILPPICMCLFRQYATCFNSGIYLIWTLLVVVGIGSVYFHATLSFLGQMLDELAVLWV |
Gene Name | ACER2 alkaline ceramidase 2 [ Homo sapiens ] |
Official Symbol | ACER2 |
Synonyms | ACER2; alkaline ceramidase 2; ASAH3L, N acylsphingosine amidohydrolase 3 like; FLJ41587; haCER2; alkCDase 2; alkaline CDase 2; ceramide hydrolase; ASAH3L; ALKCDase2; |
Gene ID | 340485 |
mRNA Refseq | NM_001010887 |
Protein Refseq | NP_001010887 |
MIM | 613492 |
UniProt ID | Q5QJU3 |
◆ Recombinant Proteins | ||
ASAH3L-879H | Recombinant Human ASAH3L protein, GST-tagged | +Inquiry |
RFL-19706MF | Recombinant Full Length Mouse Alkaline Ceramidase 2(Acer2) Protein, His-Tagged | +Inquiry |
ALK-2573H | Recombinant Human ALK protein, His-tagged | +Inquiry |
RFL-14836HF | Recombinant Full Length Human Alkaline Ceramidase 2(Acer2) Protein, His-Tagged | +Inquiry |
ACER2-1454HF | Recombinant Full Length Human ACER2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACER2 Products
Required fields are marked with *
My Review for All ACER2 Products
Required fields are marked with *
0
Inquiry Basket