Recombinant Human ACP2 protein, His-tagged
Cat.No. : | ACP2-9307H |
Product Overview : | Recombinant Human ACP2 protein(37-383 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | August 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 37-383 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | TLLYRHGDRSPVKTYPKDPYQEEEWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNGMQRFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVYDTLFCEQTHGLRLPPWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLPKLLVYSAHDTTLVALQMALDVYNGEQAPYASCHIFELYQEDSGNFSVEMYFRNESDKAPWPLSLPGCPHRCPLQDFLRLTEPVVPKDWQQECQLASGPADTEVIV |
Gene Name | ACP2 acid phosphatase 2, lysosomal [ Homo sapiens ] |
Official Symbol | ACP2 |
Synonyms | ACP2; acid phosphatase 2, lysosomal; lysosomal acid phosphatase; LAP; |
Gene ID | 53 |
mRNA Refseq | NM_001131064 |
Protein Refseq | NP_001124536 |
MIM | 171650 |
UniProt ID | P11117 |
◆ Recombinant Proteins | ||
ACP2-2666H | Recombinant Human ACP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL-29323XF | Recombinant Full Length Xenopus Laevis Lysosomal Acid Phosphatase(Acp2) Protein, His-Tagged | +Inquiry |
ACP2-801HF | Recombinant Full Length Human ACP2 Protein, GST-tagged | +Inquiry |
Acp2-515M | Recombinant Mouse Acp2 Protein, MYC/DDK-tagged | +Inquiry |
ACP2-2124Z | Recombinant Zebrafish ACP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACP2-9082HCL | Recombinant Human ACP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACP2 Products
Required fields are marked with *
My Review for All ACP2 Products
Required fields are marked with *