Recombinant Human ACSL3 protein, His-tagged

Cat.No. : ACSL3-3787H
Product Overview : Recombinant Human ACSL3 protein(42-160 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 42-160 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : YFFSESRQEKSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKT
Gene Name ACSL3 acyl-CoA synthetase long-chain family member 3 [ Homo sapiens ]
Official Symbol ACSL3
Synonyms ACSL3; acyl-CoA synthetase long-chain family member 3; FACL3, fatty acid Coenzyme A ligase, long chain 3; long-chain-fatty-acid--CoA ligase 3; ACS3; PRO2194; LACS 3; lignoceroyl-CoA synthase; long-chain acyl-CoA synthetase 3; fatty-acid-Coenzyme A ligase, long-chain 3; FACL3;
Gene ID 2181
mRNA Refseq NM_004457
Protein Refseq NP_004448
MIM 602371
UniProt ID O95573

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACSL3 Products

Required fields are marked with *

My Review for All ACSL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon