Recombinant Human ACSL3 protein, His-tagged
| Cat.No. : | ACSL3-3787H |
| Product Overview : | Recombinant Human ACSL3 protein(42-160 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 42-160 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | YFFSESRQEKSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKT |
| Gene Name | ACSL3 acyl-CoA synthetase long-chain family member 3 [ Homo sapiens ] |
| Official Symbol | ACSL3 |
| Synonyms | ACSL3; acyl-CoA synthetase long-chain family member 3; FACL3, fatty acid Coenzyme A ligase, long chain 3; long-chain-fatty-acid--CoA ligase 3; ACS3; PRO2194; LACS 3; lignoceroyl-CoA synthase; long-chain acyl-CoA synthetase 3; fatty-acid-Coenzyme A ligase, long-chain 3; FACL3; |
| Gene ID | 2181 |
| mRNA Refseq | NM_004457 |
| Protein Refseq | NP_004448 |
| MIM | 602371 |
| UniProt ID | O95573 |
| ◆ Recombinant Proteins | ||
| ACSL3-796H | Recombinant Human ACSL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ACSL3-197H | Recombinant Human ACSL3 Protein, GST-tagged | +Inquiry |
| ACSL3-126R | Recombinant Rat ACSL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ACSL3-15H | Recombinant Human ACSL3 protein, His-tagged | +Inquiry |
| Acsl3-1506M | Recombinant Mouse Acsl3 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACSL3-9076HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
| ACSL3-9077HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSL3 Products
Required fields are marked with *
My Review for All ACSL3 Products
Required fields are marked with *
