Recombinant Human Actin, Beta, His-tagged

• Cat.No.: ACTB-3030H
• Product Overview: Recombinant Human β-Actin/ACTB is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Phe375) of Human ACTB fused with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-375 a.a.
• Description: This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
• Form: Supplied as a 0.2 μm filtered solution of 10mM Tris-HCl, 0.1% TritonX-100, 2mM DTT, pH 8.0
• AA Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP AMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEA LFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTM KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCFLEHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at < -20ºC, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Shipping: The product is shipped on dry ice/ice packs.

Gene Information

• Gene Name: ACTB actin, beta [ Homo sapiens (human) ]
• Official Symbol: ACTB
• Synonyms: ACTB; actin, beta; TPT; HHG1; HLP3; PS1TP5BP1; actin, cytoplasmic 1; beta cytoskeletal actin; PS1TP5-binding protein 1; Actin, cytoplasmic 1; Beta-actin; Actin, cytoplasmic 1, N-terminally processed
• Gene ID: 60
• mRNA Refseq: NM_001101
• Protein Refseq: NP_001092
• MIM: 102630
• UniProt ID: P60709
• Chromosome Location: 7p22
• Pathway: Adherens junction; Arrhythmogenic right ventricular cardiomyopathy; Bacterial invasion of epithelial cells
• Function: ATP binding; contributes_to RNA polymerase II core promoter proximal region sequence-specific DNA binding; Tat protein binding