Recombinant Human Actin, Beta, His-tagged
Cat.No. : | ACTB-3030H |
Product Overview : | Recombinant Human β-Actin/ACTB is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Phe375) of Human ACTB fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-375 a.a. |
Description : | This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins. |
Form : | Supplied as a 0.2 μm filtered solution of 10mM Tris-HCl, 0.1% TritonX-100, 2mM DTT, pH 8.0 |
AA Sequence : | MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP AMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEA LFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTM KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCFLEHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at < -20ºC, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Shipping : | The product is shipped on dry ice/ice packs. |
Gene Name | ACTB actin, beta [ Homo sapiens (human) ] |
Official Symbol | ACTB |
Synonyms | ACTB; actin, beta; TPT; HHG1; HLP3; PS1TP5BP1; actin, cytoplasmic 1; beta cytoskeletal actin; PS1TP5-binding protein 1; Actin, cytoplasmic 1; Beta-actin; Actin, cytoplasmic 1, N-terminally processed |
Gene ID | 60 |
mRNA Refseq | NM_001101 |
Protein Refseq | NP_001092 |
MIM | 102630 |
UniProt ID | P60709 |
Chromosome Location | 7p22 |
Pathway | Adherens junction; Arrhythmogenic right ventricular cardiomyopathy; Bacterial invasion of epithelial cells |
Function | ATP binding; contributes_to RNA polymerase II core promoter proximal region sequence-specific DNA binding; Tat protein binding |
◆ Recombinant Proteins | ||
ACTB-074H | Recombinant Human ACTB Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACTB-2480H | Recombinant Human ACTB protein, His&Myc-tagged | +Inquiry |
ACTB-124H | Recombinant Human ACTB Protein, His-tagged | +Inquiry |
ACTB-938H | Recombinant Human ACTB protein, His&Myc-tagged | +Inquiry |
ACTB-1520H | Recombinant Human ACTB, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ACTB-882P | Native Porcine ACTB Protein | +Inquiry |
ACTB-325H | Active Native Human ACTB | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTB-20HCL | Recombinant Human ACTB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTB Products
Required fields are marked with *
My Review for All ACTB Products
Required fields are marked with *