Recombinant Human ACTL6B, His-tagged
Cat.No. : | ACTL6B-26300TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 5-282 of Human BAF53b with an N terminal His tag. Predicted mwt: 32 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 5-282 a.a. |
Description : | The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. This subunit may be involved in the regulation of genes by structural modulation of their chromatin, specifically in the brain. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 90 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLL AAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM SPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEA PWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANG RSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDF ISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKE KLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVA AQMPTV |
Gene Name | ACTL6B actin-like 6B [ Homo sapiens ] |
Official Symbol | ACTL6B |
Synonyms | ACTL6B; actin-like 6B; actin like 6 , ACTL6; actin-like protein 6B; BAF53B; |
Gene ID | 51412 |
mRNA Refseq | NM_016188 |
Protein Refseq | NP_057272 |
MIM | 612458 |
Uniprot ID | O94805 |
Chromosome Location | 7q22 |
Function | ATP binding; structural constituent of cytoskeleton; transcription coactivator activity; |
◆ Recombinant Proteins | ||
ACTL6B-223H | Recombinant Human ACTL6B Protein, GST-tagged | +Inquiry |
ACTL6B-846HF | Recombinant Full Length Human ACTL6B Protein, GST-tagged | +Inquiry |
Actl6b-3101R | Recombinant Rat Actl6b, His-tagged | +Inquiry |
ACTL6B-223R | Recombinant Rhesus monkey ACTL6B Protein, His-tagged | +Inquiry |
ACTL6B-301380H | Recombinant Human ACTL6B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTL6B-9060HCL | Recombinant Human ACTL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTL6B Products
Required fields are marked with *
My Review for All ACTL6B Products
Required fields are marked with *
0
Inquiry Basket