Recombinant Human ACVR2A Protein, Fc/His-tagged
Cat.No. : | ACVR2A-884H |
Product Overview : | Recombinant Human ACVR2A fused with Fc/His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Protein Length : | 20-134aa |
Description : | This gene encodes a receptor that mediates the functions of activins, which are members of the transforming growth factor-beta (TGF-beta) superfamily involved in diverse biological processes. The encoded protein is a transmembrane serine-threonine kinase receptor which mediates signaling by forming heterodimeric complexes with various combinations of type I and type II receptors and ligands in a cell-specific manner. The encoded type II receptor is primarily involved in ligand-binding and includes an extracellular ligand-binding domain, a transmembrane domain and a cytoplasmic serine-threonine kinase domain. This gene may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality. Alternative splicing results in multiple transcript variants of this gene |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
Molecular Mass : | 41.2kD |
AA Sequence : | AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | ACVR2A activin A receptor, type IIA [ Homo sapiens ] |
Official Symbol | ACVR2A |
Synonyms | ACVR2A; activin A receptor, type IIA; activin A receptor, type II , ACVR2; activin receptor type-2A; ACTRII; ACVR2; |
Gene ID | 92 |
mRNA Refseq | NM_001616 |
Protein Refseq | NP_001607 |
MIM | 102581 |
UniProt ID | P27037 |
◆ Recombinant Proteins | ||
ACVR2A-255H | Recombinant Human ACVR2A Protein, GST-tagged | +Inquiry |
ACVR2A-083H | Recombinant Human ACVR2A Protein, Fc-tagged | +Inquiry |
Acvr2a-01M | Active Recombinant Mouse Acvr2a Protein, mFc tagged | +Inquiry |
ACVR2A-831HF | Recombinant Full Length Human ACVR2A Protein, GST-tagged | +Inquiry |
ACVR2A-494R | Recombinant Rat ACVR2A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR2A-3096HCL | Recombinant Human ACVR2A cell lysate | +Inquiry |
ACVR2A-2280MCL | Recombinant Mouse ACVR2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACVR2A Products
Required fields are marked with *
My Review for All ACVR2A Products
Required fields are marked with *
0
Inquiry Basket