Recombinant Human ACVR2A Protein, Fc tagged
Cat.No. : | ACVR2A-14H |
Product Overview : | Recombinant Human ACVR2A Protein with Fc-tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Fc |
Protein Length : | 21-134aa |
Description : | This gene encodes a receptor that mediates the functions of activins, which are members of the transforming growth factor-beta (TGF-beta) superfamily involved in diverse biological processes. The encoded protein is a transmembrane serine-threonine kinase receptor which mediates signaling by forming heterodimeric complexes with various combinations of type I and type II receptors and ligands in a cell-specific manner. The encoded type II receptor is primarily involved in ligand-binding and includes an extracellular ligand-binding domain, a transmembrane domain and a cytoplasmic serine-threonine kinase domain. This gene may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality. Alternative splicing results in multiple transcript variants of this gene. |
AA Sequence : | ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | < 1.0 EU/μg of the protein as determined by the LAL method. |
Purity : | > 90% as determined by SDS-PAGE |
Stability : | Stable for at least 1 year from receipt of products under proper storage and handling conditions |
Storage : | Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | PBS buffer |
Gene Name | ACVR2A activin A receptor, type IIA [ Homo sapiens (human) ] |
Official Symbol | ACVR2A |
Synonyms | ACVR2A; activin A receptor, type IIA; activin A receptor, type II, ACVR2; activin receptor type-2A; ACTRII; ACVR2; |
Gene ID | 92 |
mRNA Refseq | NM_001616 |
Protein Refseq | NP_001607 |
MIM | 102581 |
UniProt ID | P27037 |
◆ Recombinant Proteins | ||
ACVR2A-26487TH | Recombinant Human ACVR2A | +Inquiry |
ACVR2A-07HF | Recombinant Full Length Human ACVR2A Protein | +Inquiry |
ACVR2A-254H | Active Recombinant Human ACVR2A Protein, GST-tagged | +Inquiry |
ACVR2A-831HF | Recombinant Full Length Human ACVR2A Protein, GST-tagged | +Inquiry |
ACVR2A-1585H | Recombinant Human Activin A Receptor, Type IIA | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR2A-3096HCL | Recombinant Human ACVR2A cell lysate | +Inquiry |
ACVR2A-2280MCL | Recombinant Mouse ACVR2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACVR2A Products
Required fields are marked with *
My Review for All ACVR2A Products
Required fields are marked with *
0
Inquiry Basket