Recombinant Human ACVR2A Protein, Fc tagged

Cat.No. : ACVR2A-14H
Product Overview : Recombinant Human ACVR2A Protein with Fc-tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : Fc
Protein Length : 21-134aa
Description : This gene encodes a receptor that mediates the functions of activins, which are members of the transforming growth factor-beta (TGF-beta) superfamily involved in diverse biological processes. The encoded protein is a transmembrane serine-threonine kinase receptor which mediates signaling by forming heterodimeric complexes with various combinations of type I and type II receptors and ligands in a cell-specific manner. The encoded type II receptor is primarily involved in ligand-binding and includes an extracellular ligand-binding domain, a transmembrane domain and a cytoplasmic serine-threonine kinase domain. This gene may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality. Alternative splicing results in multiple transcript variants of this gene.
AA Sequence : ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : < 1.0 EU/μg of the protein as determined by the LAL method.
Purity : > 90% as determined by SDS-PAGE
Stability : Stable for at least 1 year from receipt of products under proper storage and handling conditions
Storage : Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : PBS buffer
Gene Name ACVR2A activin A receptor, type IIA [ Homo sapiens (human) ]
Official Symbol ACVR2A
Synonyms ACVR2A; activin A receptor, type IIA; activin A receptor, type II, ACVR2; activin receptor type-2A; ACTRII; ACVR2;
Gene ID 92
mRNA Refseq NM_001616
Protein Refseq NP_001607
MIM 102581
UniProt ID P27037

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACVR2A Products

Required fields are marked with *

My Review for All ACVR2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon