Recombinant Human ADAM12 protein, GST-tagged
Cat.No. : | ADAM12-1933H |
Product Overview : | Recombinant Human ADAM12 protein(31-350 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 31-350 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | VSLWNQGRADEVVSASVRSGDLWIPVKSFDSKNHPEVLNIRLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTGHCYYHGHVRGYSDSAVSLSTCSGLRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCGSHHNTPNLAAKNVFPPPSQTWARRHKRETLKATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAHELG |
Gene Name | ADAM12 ADAM metallopeptidase domain 12 [ Homo sapiens ] |
Official Symbol | ADAM12 |
Synonyms | ADAM12; ADAM metallopeptidase domain 12; a disintegrin and metalloproteinase domain 12 (meltrin alpha); disintegrin and metalloproteinase domain-containing protein 12; MCMPMltna; meltrin alpha; MLTN; meltrin-alpha; MCMP; MLTNA; |
Gene ID | 8038 |
mRNA Refseq | NM_003474 |
Protein Refseq | NP_003465 |
MIM | 602714 |
UniProt ID | O43184 |
◆ Recombinant Proteins | ||
ADAM12-0256H | Recombinant Human ADAM12 Protein (Val31-His350), N-His-tagged | +Inquiry |
ADAM12-74H | Recombinant Human ADAM12 Protein, His-tagged | +Inquiry |
ADAM12-1933H | Recombinant Human ADAM12 protein, GST-tagged | +Inquiry |
ADAM12-538H | Recombinant Human ADAM12 Protein | +Inquiry |
ADAM12-307M | Recombinant Mouse ADAM12 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM12-2592HCL | Recombinant Human ADAM12 cell lysate | +Inquiry |
CPBT-676RH | Rabbit Anti-Human ADAM Metallopeptidase Domain 12 Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM12 Products
Required fields are marked with *
My Review for All ADAM12 Products
Required fields are marked with *
0
Inquiry Basket