Recombinant Human ADAM17 protein, GST-tagged
| Cat.No. : | ADAM17-2734H |
| Product Overview : | Recombinant Human ADAM17 protein(693-824 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 693-824 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | CVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC |
| Gene Name | ADAM17 ADAM metallopeptidase domain 17 [ Homo sapiens ] |
| Official Symbol | ADAM17 |
| Synonyms | ADAM17; ADAM metallopeptidase domain 17; TACE, tumor necrosis factor, alpha, converting enzyme; disintegrin and metalloproteinase domain-containing protein 17; CD156B; cSVP; TNF-alpha convertase; snake venom-like protease; TNF-alpha converting enzyme; ADAM metallopeptidase domain 18; tumor necrosis factor, alpha, converting enzyme; CSVP; TACE; NISBD; ADAM18; |
| Gene ID | 6868 |
| mRNA Refseq | NM_003183 |
| Protein Refseq | NP_003174 |
| MIM | 603639 |
| UniProt ID | P78536 |
| ◆ Recombinant Proteins | ||
| ADAM17-5123H | Recombinant Human ADAM17 Protein (Met1-Asp563), C-His tagged | +Inquiry |
| ADAM17-26135TH | Recombinant Human ADAM17 | +Inquiry |
| ADAM17-501R | Recombinant Rat ADAM17 Protein | +Inquiry |
| ADAM17-7114H | Recombinant Human ADAM17 protein, His-tagged | +Inquiry |
| Adam17-7115R | Recombinant Rat Adam17 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADAM17-1198RCL | Recombinant Rat ADAM17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM17 Products
Required fields are marked with *
My Review for All ADAM17 Products
Required fields are marked with *
