Recombinant Human ADAM2 Protein, GST-tagged

Cat.No. : ADAM2-280H
Product Overview : Human ADAM2 partial ORF ( NP_001455, 376 a.a. - 475 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded protein is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]
Molecular Mass : 36.74 kDa
AA Sequence : RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADAM2 ADAM metallopeptidase domain 2 [ Homo sapiens ]
Official Symbol ADAM2
Synonyms ADAM2; ADAM metallopeptidase domain 2; fertilin beta , FTNB; disintegrin and metalloproteinase domain-containing protein 2; cancer/testis antigen 15; CT15; PH 30b; PH30; PH-30; ADAM 2; PH30-beta; fertilin beta; fertilin subunit beta; FTNB; CRYN1; CRYN2; PH-30b;
Gene ID 2515
mRNA Refseq NM_001464
Protein Refseq NP_001455
MIM 601533
UniProt ID Q99965

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAM2 Products

Required fields are marked with *

My Review for All ADAM2 Products

Required fields are marked with *

0
cart-icon