Recombinant Human ADAM22 protein, His-tagged

• Cat.No.: ADAM22-3676H
• Product Overview: Recombinant Human ADAM22 protein(770 - 870 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 770 - 870 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: GLSHSWSERIPDTKHISDICENGRPRSNSWQGNLGGNKKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ADAM22 ADAM metallopeptidase domain 22 [ Homo sapiens ]
• Official Symbol: ADAM22
• Synonyms: ADAM22; ADAM metallopeptidase domain 22; a disintegrin and metalloproteinase domain 22; disintegrin and metalloproteinase domain-containing protein 22; MDC2; metalloproteinase like; disintegrin like; and cysteine rich protein 2; metalloproteinase-disintegrin ADAM22-3; metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2; ADAM 22; MGC149832
• Gene ID: 53616
• mRNA Refseq: NM_004194
• Protein Refseq: NP_004185
• MIM: 603709
• UniProt ID: Q9P0K1