Recombinant Human ADAM8 protein, His-tagged
| Cat.No. : | ADAM8-3623H |
| Product Overview : | Recombinant Human ADAM8 protein(17-198 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 17-198 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | IAPSRPWALMEQYEVVLPRRLPGPRVRRALPSHLGLHPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAASLSTCAGLRGFFQVGSDLHLIEPLDEGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPRPGDSLPSRE |
| Gene Name | ADAM8 ADAM metallopeptidase domain 8 [ Homo sapiens ] |
| Official Symbol | ADAM8 |
| Synonyms | ADAM8; ADAM metallopeptidase domain 8; a disintegrin and metalloproteinase domain 8; disintegrin and metalloproteinase domain-containing protein 8; CD156; MS2; cell surface antigen MS2; human leukocyte differentiation antigen; MGC134985; |
| Gene ID | 101 |
| mRNA Refseq | NM_001109 |
| Protein Refseq | NP_001100 |
| MIM | 602267 |
| UniProt ID | P78325 |
| ◆ Recombinant Proteins | ||
| ADAM8-615H | Recombinant Human ADAM8 protein, His & T7-tagged | +Inquiry |
| ADAM8-525H | Active Recombinant Human ADAM Metallopeptidase Domain 8, His-tagged | +Inquiry |
| ADAM8-320M | Recombinant Mouse ADAM8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADAM8-3623H | Recombinant Human ADAM8 protein, His-tagged | +Inquiry |
| ADAM8-004H | Recombinant Human ADAM8 Protein, C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADAM8-855CCL | Recombinant Cynomolgus ADAM8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM8 Products
Required fields are marked with *
My Review for All ADAM8 Products
Required fields are marked with *



