Recombinant Human ADAMTS10 protein, His-tagged

Cat.No. : ADAMTS10-6744H
Product Overview : Recombinant Human ADAMTS10 protein(896-1072 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 896-1072 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : CSRSCDAGVRSRSVVCQRRVSAAEEKALDDSACPQPRPPVLEACHGPTCPPEWAALDWSECTPSCGPGLRHRVVLCKSADHRATLPPAHCSPAAKPPATMRCNLRRCPPARWVAGEWGECSAQCGVGQRQRSVRCTSHTGQASHECTEALRPPTTQQCEAKCDSPTPGDGPEECKDV
Gene Name ADAMTS10 ADAM metallopeptidase with thrombospondin type 1 motif, 10 [ Homo sapiens ]
Official Symbol ADAMTS10
Synonyms ADAMTS10; ADAM metallopeptidase with thrombospondin type 1 motif, 10; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 10; A disintegrin and metalloproteinase with thrombospondin motifs 10; ADAM TS10; ADAMTS-10; ADAM-TS 10; zinc metalloendopeptidase; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 10; WMS; WMS1; ADAM-TS10;
Gene ID 81794
mRNA Refseq NM_030957
Protein Refseq NP_112219
MIM 608990
UniProt ID Q9H324

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMTS10 Products

Required fields are marked with *

My Review for All ADAMTS10 Products

Required fields are marked with *

0
cart-icon