Recombinant Human ADAMTS10 protein, His-tagged
Cat.No. : | ADAMTS10-6744H |
Product Overview : | Recombinant Human ADAMTS10 protein(896-1072 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 896-1072 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | CSRSCDAGVRSRSVVCQRRVSAAEEKALDDSACPQPRPPVLEACHGPTCPPEWAALDWSECTPSCGPGLRHRVVLCKSADHRATLPPAHCSPAAKPPATMRCNLRRCPPARWVAGEWGECSAQCGVGQRQRSVRCTSHTGQASHECTEALRPPTTQQCEAKCDSPTPGDGPEECKDV |
Gene Name | ADAMTS10 ADAM metallopeptidase with thrombospondin type 1 motif, 10 [ Homo sapiens ] |
Official Symbol | ADAMTS10 |
Synonyms | ADAMTS10; ADAM metallopeptidase with thrombospondin type 1 motif, 10; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 10; A disintegrin and metalloproteinase with thrombospondin motifs 10; ADAM TS10; ADAMTS-10; ADAM-TS 10; zinc metalloendopeptidase; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 10; WMS; WMS1; ADAM-TS10; |
Gene ID | 81794 |
mRNA Refseq | NM_030957 |
Protein Refseq | NP_112219 |
MIM | 608990 |
UniProt ID | Q9H324 |
◆ Recombinant Proteins | ||
ADAMTS10-6664Z | Recombinant Zebrafish ADAMTS10 | +Inquiry |
ADAMTS10-235R | Recombinant Rhesus monkey ADAMTS10 Protein, His-tagged | +Inquiry |
ADAMTS10-1759H | Recombinant Human ADAMTS10 protein, His & T7-tagged | +Inquiry |
ADAMTS10-63R | Recombinant Rhesus Macaque ADAMTS10 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAMTS10-322M | Recombinant Mouse ADAMTS10 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAMTS10-9032HCL | Recombinant Human ADAMTS10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS10 Products
Required fields are marked with *
My Review for All ADAMTS10 Products
Required fields are marked with *