Recombinant Human ADAMTS2 protein, GST-tagged
| Cat.No. : | ADAMTS2-1955H |
| Product Overview : | Recombinant Human ADAMTS2 protein(1091-1211 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1091-1211 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | KSCNLYNNLTNVEGRIEPPPGKHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGKF |
| Gene Name | ADAMTS2 ADAM metallopeptidase with thrombospondin type 1 motif, 2 [ Homo sapiens ] |
| Official Symbol | ADAMTS2 |
| Synonyms | ADAMTS2; ADAM metallopeptidase with thrombospondin type 1 motif, 2; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; A disintegrin and metalloproteinase with thrombospondin motifs 2; ADAM TS2; ADAMTS 3; hPCPNI; NPI; PCINP; procollagen I N proteinase; procollagen N endopeptidase; procollagen I N-proteinase; procollagen N-endopeptidase; procollagen I/II amino propeptide-processing enzyme; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; PNPI; PCPNI; PCI-NP; PC I-NP; ADAM-TS2; ADAMTS-2; ADAMTS-3; DKFZp686F12218; |
| Gene ID | 9509 |
| mRNA Refseq | NM_014244 |
| Protein Refseq | NP_055059 |
| MIM | 604539 |
| UniProt ID | O95450 |
| ◆ Recombinant Proteins | ||
| ADAMTS2-304H | Recombinant Human ADAMTS2 Protein, GST-tagged | +Inquiry |
| ADAMTS2-1779H | Recombinant Human ADAMTS2 Protein, His&Myc-tagged | +Inquiry |
| ADAMTS2-1954H | Recombinant Human ADAMTS2 protein, His-tagged | +Inquiry |
| ADAMTS2-1778H | Recombinant Human ADAMTS2 protein, His & SUMO-tagged | +Inquiry |
| ADAMTS2-3007C | Recombinant Cattle ADAMTS2, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS2 Products
Required fields are marked with *
My Review for All ADAMTS2 Products
Required fields are marked with *
