Recombinant Human ADAMTS2 Protein, His&Myc-tagged
Cat.No. : | ADAMTS2-1779H |
Product Overview : | Recombinant Human ADAMTS2 protein(NP_055059)(254-492aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 254-492aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.2 kDa |
AA Sequence : | RRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHDEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQLPGLHYSMNEQC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ADAMTS2 ADAM metallopeptidase with thrombospondin type 1 motif, 2 [ Homo sapiens ] |
Official Symbol | ADAMTS2 |
Synonyms | ADAMTS2; ADAM metallopeptidase with thrombospondin type 1 motif, 2; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; A disintegrin and metalloproteinase with thrombospondin motifs 2; ADAM TS2; ADAMTS 3; hPCPNI; NPI; PCINP; procollagen I N proteinase; procollagen N endopeptidase; procollagen I N-proteinase; procollagen N-endopeptidase; procollagen I/II amino propeptide-processing enzyme; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; PNPI; PCPNI; PCI-NP; PC I-NP; ADAM-TS2; ADAMTS-2; ADAMTS-3; DKFZp686F12218; |
Gene ID | 9509 |
mRNA Refseq | NM_014244 |
Protein Refseq | NP_055059 |
MIM | 604539 |
UniProt ID | O95450 |
◆ Recombinant Proteins | ||
ADAMTS2-3007C | Recombinant Cattle ADAMTS2, His-tagged | +Inquiry |
ADAMTS2-1778H | Recombinant Human ADAMTS2 protein, His & SUMO-tagged | +Inquiry |
ADAMTS2-1779H | Recombinant Human ADAMTS2 Protein, His&Myc-tagged | +Inquiry |
ADAMTS2-1955H | Recombinant Human ADAMTS2 protein, GST-tagged | +Inquiry |
ADAMTS2-304H | Recombinant Human ADAMTS2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS2 Products
Required fields are marked with *
My Review for All ADAMTS2 Products
Required fields are marked with *