Recombinant Human ADAMTSL1 Protein, GST-tagged
Cat.No. : | ADAMTSL1-311H |
Product Overview : | Human ADAMTSL1 partial ORF ( NP_644669.1, 192 a.a. - 291 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a secreted protein and member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family. This protein lacks the metalloproteinase and disintegrin-like domains, which are typical of the ADAMTS family, but contains other ADAMTS domains, including the thrombospondin type 1 motif. This protein may have important functions in the extracellular matrix. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | YKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLNSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADAMTSL1 ADAMTS-like 1 [ Homo sapiens ] |
Official Symbol | ADAMTSL1 |
Synonyms | ADAMTSL1; ADAMTS-like 1; C9orf94, chromosome 9 open reading frame 94; ADAMTS-like protein 1; ADAMTSR1; FLJ35283; punctin; punctin-1; ADAM-TS related protein 1; C9orf94; PUNCTIN; ADAMTSL-1; FLJ41032; FLJ46891; MGC40193; MGC118803; MGC118805; DKFZp686L03130; |
Gene ID | 92949 |
mRNA Refseq | NM_001040272 |
Protein Refseq | NP_001035362 |
MIM | 609198 |
UniProt ID | Q8N6G6 |
◆ Recombinant Proteins | ||
ADAMTSL1-311H | Recombinant Human ADAMTSL1 Protein, GST-tagged | +Inquiry |
ADAMTSL1-310H | Recombinant Human ADAMTSL1 Protein, GST-tagged | +Inquiry |
ADAMTSL1-919HF | Recombinant Full Length Human ADAMTSL1 Protein, GST-tagged | +Inquiry |
Adamtsl1-1532M | Recombinant Mouse Adamtsl1 Protein, Myc/DDK-tagged | +Inquiry |
ADAMTSL1-5240H | Recombinant Human ADAMTSL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAMTSL1-001HCL | Recombinant Human ADAMTSL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTSL1 Products
Required fields are marked with *
My Review for All ADAMTSL1 Products
Required fields are marked with *