Recombinant Human ADCY3 Protein, GST-tagged

Cat.No. : ADCY3-328H
Product Overview : Human ADCY3 partial ORF ( NP_004027, 1035 a.a. - 1144 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes adenylyl cyclase 3 which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This protein appears to be widely expressed in various human tissues and may be involved in a number of physiological and pathophysiological metabolic processes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]
Molecular Mass : 37.84 kDa
AA Sequence : FNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGPSVTLPHQVVDNS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADCY3 adenylate cyclase 3 [ Homo sapiens ]
Official Symbol ADCY3
Synonyms ADCY3; adenylate cyclase 3; adenylate cyclase type 3; AC3; AC-III; adenylyl cyclase 3; ATP pyrophosphate-lyase 3; adenylate cyclase type III; adenylyl cyclase, type III; adenylate cyclase, olfactive type; KIAA0511;
Gene ID 109
mRNA Refseq NM_004036
Protein Refseq NP_004027
MIM 600291
UniProt ID O60266

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADCY3 Products

Required fields are marked with *

My Review for All ADCY3 Products

Required fields are marked with *

0
cart-icon