Recombinant Human ADCY3 Protein, GST-tagged
Cat.No. : | ADCY3-328H |
Product Overview : | Human ADCY3 partial ORF ( NP_004027, 1035 a.a. - 1144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes adenylyl cyclase 3 which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This protein appears to be widely expressed in various human tissues and may be involved in a number of physiological and pathophysiological metabolic processes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | FNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGPSVTLPHQVVDNS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADCY3 adenylate cyclase 3 [ Homo sapiens ] |
Official Symbol | ADCY3 |
Synonyms | ADCY3; adenylate cyclase 3; adenylate cyclase type 3; AC3; AC-III; adenylyl cyclase 3; ATP pyrophosphate-lyase 3; adenylate cyclase type III; adenylyl cyclase, type III; adenylate cyclase, olfactive type; KIAA0511; |
Gene ID | 109 |
mRNA Refseq | NM_004036 |
Protein Refseq | NP_004027 |
MIM | 600291 |
UniProt ID | O60266 |
◆ Recombinant Proteins | ||
PRAP1-13304M | Recombinant Mouse PRAP1 Protein | +Inquiry |
RFL4690BF | Recombinant Full Length Bacillus Cereus Protein Crcb Homolog 2(Crcb2) Protein, His-Tagged | +Inquiry |
AKAP6-32H | Recombinant Human AKAP6 protein, GST-tagged | +Inquiry |
CCR2-3954H | Active Recombinant Human CCR2 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
RPS6KA2-1150H | Recombinant Human RPS6KA2 Protein (M1-L733), Tag Free | +Inquiry |
◆ Native Proteins | ||
TF-132B | Native Bovine Transferrin | +Inquiry |
ORM1-35H | Native Human Alpha 1 Acid Glycoprotein | +Inquiry |
Prothrombin-92M | Native Mouse Prothrombin | +Inquiry |
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
MB-01B | Native Bovine MB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPX-2789HCL | Recombinant Human HPX cell lysate | +Inquiry |
CRYM-7254HCL | Recombinant Human CRYM 293 Cell Lysate | +Inquiry |
DENND1A-6978HCL | Recombinant Human DENND1A 293 Cell Lysate | +Inquiry |
KIF6-932HCL | Recombinant Human KIF6 cell lysate | +Inquiry |
NOS2-3759HCL | Recombinant Human NOS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADCY3 Products
Required fields are marked with *
My Review for All ADCY3 Products
Required fields are marked with *
0
Inquiry Basket