Recombinant Human ADCY3 Protein, GST-tagged

• Cat.No.: ADCY3-328H
• Product Overview: Human ADCY3 partial ORF ( NP_004027, 1035 a.a. - 1144 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes adenylyl cyclase 3 which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This protein appears to be widely expressed in various human tissues and may be involved in a number of physiological and pathophysiological metabolic processes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]
• Molecular Mass: 37.84 kDa
• AA Sequence: FNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGPSVTLPHQVVDNS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADCY3 adenylate cyclase 3 [ Homo sapiens ]
• Official Symbol: ADCY3
• Synonyms: ADCY3; adenylate cyclase 3; adenylate cyclase type 3; AC3; AC-III; adenylyl cyclase 3; ATP pyrophosphate-lyase 3; adenylate cyclase type III; adenylyl cyclase, type III; adenylate cyclase, olfactive type; KIAA0511
• Gene ID: 109
• mRNA Refseq: NM_004036
• Protein Refseq: NP_004027
• MIM: 600291
• UniProt ID: O60266