Recombinant Human ADCYAP1 Protein, GST-tagged
Cat.No. : | ADCYAP1-333H |
Product Overview : | Human ADCYAP1 full-length ORF ( AAH93837.1, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013] |
Molecular Mass : | 45.2 kDa |
AA Sequence : | MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADCYAP1 adenylate cyclase activating polypeptide 1 (pituitary) [ Homo sapiens ] |
Official Symbol | ADCYAP1 |
Synonyms | ADCYAP1; adenylate cyclase activating polypeptide 1 (pituitary); pituitary adenylate cyclase-activating polypeptide; PACAP; MGC126852; |
Gene ID | 116 |
mRNA Refseq | NM_001099733 |
Protein Refseq | NP_001093203 |
MIM | 102980 |
UniProt ID | P18509 |
◆ Recombinant Proteins | ||
ADCYAP1-1078C | Recombinant Chicken ADCYAP1 | +Inquiry |
ADCYAP1-520R | Recombinant Rat ADCYAP1 Protein | +Inquiry |
ADCYAP1-4155H | Recombinant Human ADCYAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Adcyap1-538M | Recombinant Mouse Adcyap1 Protein, MYC/DDK-tagged | +Inquiry |
ADCYAP1-334H | Recombinant Human ADCYAP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADCYAP1-9019HCL | Recombinant Human ADCYAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADCYAP1 Products
Required fields are marked with *
My Review for All ADCYAP1 Products
Required fields are marked with *