Recombinant Human ADD2 protein, GST-tagged
Cat.No. : | ADD2-301607H |
Product Overview : | Recombinant Human ADD2 (1-331 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Leu331 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
AA Sequence : | MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAADLRQDFNLMEQKKRVTMILQSPSFREELEGLIQEQMKKGNNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSSCFPVDTTGFCLHSAIYAARPDVRCIIHLHTPATAAVSAMKWGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGPTCKILVLRNHGVVALGDTVEEAFYKIFHLQAACEIQVSALSSAGGVENLIL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ADD2 adducin 2 (beta) [ Homo sapiens ] |
Official Symbol | ADD2 |
Synonyms | ADD2; adducin 2 (beta); beta-adducin; ADDB; erythrocyte adducin subunit beta; |
Gene ID | 119 |
mRNA Refseq | NM_001185054 |
Protein Refseq | NP_001171983 |
MIM | 102681 |
UniProt ID | P35612 |
◆ Recombinant Proteins | ||
ADD2-6323H | Recombinant Human ADD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADD2-2935H | Recombinant Human ADD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADD2-26138TH | Recombinant Human ADD2 | +Inquiry |
ADD2-71R | Recombinant Rhesus Macaque ADD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADD2-337H | Recombinant Human ADD2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADD2-9015HCL | Recombinant Human ADD2 293 Cell Lysate | +Inquiry |
ADD2-9016HCL | Recombinant Human ADD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADD2 Products
Required fields are marked with *
My Review for All ADD2 Products
Required fields are marked with *
0
Inquiry Basket