Recombinant Human ADH5, His-tagged

• Cat.No.: ADH5-27095TH
• Product Overview: Recombinant fragment, corresponding to amino acids 111-374 of Human ADH5 with an N terminal His tag. Predicted mwt: 29 kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 111-374 a.a.
• Description: This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 105 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: CQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYT VVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAK LEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDK FARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSF ECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATR PFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDE FVTHNLSFDEINKAFELMHSGKSIRTVVKI

Gene Information

• Gene Name: ADH5 alcohol dehydrogenase 5 (class III), chi polypeptide [ Homo sapiens ]
• Official Symbol: ADH5
• Synonyms: ADH5; alcohol dehydrogenase 5 (class III), chi polypeptide; FDH, formaldehyde dehydrogenase; alcohol dehydrogenase class-3; ADH 3; ADHX
• Gene ID: 128
• mRNA Refseq: NM_000671
• Protein Refseq: NP_000662
• MIM: 103710
• Uniprot ID: P11766
• Chromosome Location: 4q23
• Pathway: Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem; Glycolysis / Gluconeogenesis, organism-specific biosystem
• Function: S-(hydroxymethyl)glutathione dehydrogenase activity; alcohol dehydrogenase (NAD) activity; electron carrier activity; fatty acid binding; formaldehyde dehydrogenase activity