Recombinant Human ADH5, His-tagged
| Cat.No. : | ADH5-27095TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 111-374 of Human ADH5 with an N terminal His tag. Predicted mwt: 29 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 111-374 a.a. |
| Description : | This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 105 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | CQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYT VVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAK LEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDK FARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSF ECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATR PFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDE FVTHNLSFDEINKAFELMHSGKSIRTVVKI |
| Gene Name | ADH5 alcohol dehydrogenase 5 (class III), chi polypeptide [ Homo sapiens ] |
| Official Symbol | ADH5 |
| Synonyms | ADH5; alcohol dehydrogenase 5 (class III), chi polypeptide; FDH, formaldehyde dehydrogenase; alcohol dehydrogenase class-3; ADH 3; ADHX; |
| Gene ID | 128 |
| mRNA Refseq | NM_000671 |
| Protein Refseq | NP_000662 |
| MIM | 103710 |
| Uniprot ID | P11766 |
| Chromosome Location | 4q23 |
| Pathway | Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem; Glycolysis / Gluconeogenesis, organism-specific biosystem; |
| Function | S-(hydroxymethyl)glutathione dehydrogenase activity; alcohol dehydrogenase (NAD) activity; electron carrier activity; fatty acid binding; formaldehyde dehydrogenase activity; |
| ◆ Recombinant Proteins | ||
| ADH5-13564H | Recombinant Human ADH5, His-tagged | +Inquiry |
| ADH5-2175HFL | Recombinant Full Length Human ADH5 Protein, C-Flag-tagged | +Inquiry |
| ADH5-927HF | Recombinant Full Length Human ADH5 Protein, GST-tagged | +Inquiry |
| ADH5-524R | Recombinant Rat ADH5 Protein | +Inquiry |
| Adh5-543M | Recombinant Mouse Adh5 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADH5-30HCL | Recombinant Human ADH5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADH5 Products
Required fields are marked with *
My Review for All ADH5 Products
Required fields are marked with *
