Recombinant Human ADIPOQ Protein, His-tagged
Cat.No. : | ADIPOQ-02H |
Product Overview : | Recombinant human ADIPOQ (106-242, 146aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 106-242 |
Description : | This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Form : | Liquid |
Molecular Mass : | 16.9 kDa |
AA Sequence : | ADPEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDHHHHHH |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Storage : | Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo sapiens (human) ] |
Official Symbol | ADIPOQ |
Synonyms | ADIPOQ; adiponectin, C1Q and collagen domain containing; ACDC; ADPN; APM1; APM-1; GBP28; ACRP30; ADIPQTL1; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; adipose specific collagen-like factor; gelatin-binding protein 28 |
Gene ID | 9370 |
mRNA Refseq | NM_004797 |
Protein Refseq | NP_004788 |
MIM | 605441 |
UniProt ID | Q15848 |
◆ Recombinant Proteins | ||
ADIPOQ-189D | Recombinant Dog ADIPOQ, Globular Domain, FLAG-tagged | +Inquiry |
ADIPOQ-0394H | Recombinant Human ADIPOQ Protein (Glu19-Asn244), C-His-tagged | +Inquiry |
ADIPOQ-2645C | Recombinant Cattle ADIPOQ protein, His-tagged | +Inquiry |
ADIPOQ-490H | Active Recombinant Human Adiponectin, C1Q And Collagen Domain Containing | +Inquiry |
ADIPOQ-4473B | Recombinant Bovine ADIPOQ protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
ADIPOQ-1526HCL | Recombinant Human ADIPOQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADIPOQ Products
Required fields are marked with *
My Review for All ADIPOQ Products
Required fields are marked with *
0
Inquiry Basket