Recombinant Human ADIPOQ Protein, His-tagged

Cat.No. : ADIPOQ-02H
Product Overview : Recombinant human ADIPOQ (106-242, 146aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using
conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 106-242
Description : This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Form : Liquid
Molecular Mass : 16.9 kDa
AA Sequence : ADPEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDHHHHHH
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Storage : Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo sapiens (human) ]
Official Symbol ADIPOQ
Synonyms ADIPOQ; adiponectin, C1Q and collagen domain containing; ACDC; ADPN; APM1; APM-1; GBP28; ACRP30; ADIPQTL1; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; adipose specific collagen-like factor; gelatin-binding protein 28
Gene ID 9370
mRNA Refseq NM_004797
Protein Refseq NP_004788
MIM 605441
UniProt ID Q15848

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADIPOQ Products

Required fields are marked with *

My Review for All ADIPOQ Products

Required fields are marked with *

0

Inquiry Basket

cartIcon