Recombinant Human ADRBK2 Protein, GST-tagged
Cat.No. : | ADRBK2-387H |
Product Overview : | Human ADRBK2 partial ORF ( AAH36797, 48 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | AERNEITFDKIFNQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQVTSTLFQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADRBK2 adrenergic, beta, receptor kinase 2 [ Homo sapiens ] |
Official Symbol | ADRBK2 |
Synonyms | ADRBK2; adrenergic, beta, receptor kinase 2; beta-adrenergic receptor kinase 2; BARK2; GRK3; beta-ARK-2; G-protein-coupled receptor kinase 3; |
Gene ID | 157 |
mRNA Refseq | NM_005160 |
Protein Refseq | NP_005151 |
MIM | 109636 |
UniProt ID | P35626 |
◆ Recombinant Proteins | ||
ADRBK2-7175Z | Recombinant Zebrafish ADRBK2 | +Inquiry |
ADRBK2-203R | Recombinant Rat ADRBK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADRBK2-969HF | Recombinant Full Length Human ADRBK2 Protein, GST-tagged | +Inquiry |
ADRBK2-3533H | Recombinant Human ADRBK2 protein, His-tagged | +Inquiry |
ADRBK2-386H | Recombinant Human ADRBK2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADRBK2-13HCL | Recombinant Human ADRBK2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADRBK2 Products
Required fields are marked with *
My Review for All ADRBK2 Products
Required fields are marked with *
0
Inquiry Basket