"ADRBK2" Related Products

Expand

Recombinant Human ADRBK2 Protein, GST-tagged

Cat.No. : ADRBK2-387H
Product Overview : Human ADRBK2 partial ORF ( AAH36797, 48 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.
Description : The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function. [provided by RefSeq, Jul 2008]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.63 kDa
AA Sequence : AERNEITFDKIFNQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQVTSTLFQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : ADRBK2 adrenergic, beta, receptor kinase 2 [ Homo sapiens ]
Official Symbol : ADRBK2
Synonyms : ADRBK2; adrenergic, beta, receptor kinase 2; beta-adrenergic receptor kinase 2; BARK2; GRK3; beta-ARK-2; G-protein-coupled receptor kinase 3;
Gene ID : 157
mRNA Refseq : NM_005160
Protein Refseq : NP_005151
MIM : 109636
UniProt ID : P35626

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.