Recombinant Human AGL protein, GST-tagged
Cat.No. : | AGL-301513H |
Product Overview : | Recombinant Human AGL (258-424 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ser258-Pro424 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | SCDVAEGKYKEKGIPALIENDHHMNSIRKIIWEDIFPKLKLWEFFQVDVNKAVEQFRRLLTQENRRVTKSDPNQHLTIIQDPEYRRFGCTVDMNIALTTFIPHDKGPAAIEECCNWFHKRMEELNSEKHRLINYHQEQAVNCLLGNVFYERLAGHGPKLGPVTRKHP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | AGL amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase [ Homo sapiens ] |
Official Symbol | AGL |
Synonyms | AGL; amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase; amylo 1, 6 glucosidase, 4 alpha glucanotransferase; glycogen debranching enzyme; glycogen storage disease type III; glycogen debrancher; amylo-1, 6-glucosidase, 4-alpha-glucanotransferase; GDE; |
Gene ID | 178 |
mRNA Refseq | NM_000028 |
Protein Refseq | NP_000019 |
MIM | 610860 |
UniProt ID | P35573 |
◆ Recombinant Proteins | ||
AGL-2739H | Recombinant Human AGL protein(731-830 aa), C-His-tagged | +Inquiry |
AGL-301513H | Recombinant Human AGL protein, GST-tagged | +Inquiry |
Agl-1554M | Recombinant Mouse Agl Protein, Myc/DDK-tagged | +Inquiry |
AGL-4532H | Recombinant Human AGL protein, His-tagged | +Inquiry |
Agl-93M | Recombinant Mouse Agl Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGL-8980HCL | Recombinant Human AGL 293 Cell Lysate | +Inquiry |
AGL-8979HCL | Recombinant Human AGL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGL Products
Required fields are marked with *
My Review for All AGL Products
Required fields are marked with *
0
Inquiry Basket