Recombinant Human AGTR2 protein, His/SUMO-tagged

Cat.No. : AGTR2-33H
Product Overview : Recombinant Human AGTR2(1-45aa) fused with His/SUMO tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-45aa
Description : The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked mental retardation.
Form : 20mM Tris-HCl based buffer,pH8.0
AA Sequence : MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD
Purity : Greater than 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigradefor up to one week.
Gene Name AGTR2 angiotensin II receptor, type 2 [ Homo sapiens ]
Official Symbol AGTR2
Synonyms AGTR2; angiotensin II receptor, type 2; angiotensin receptor 2; type-2 angiotensin II receptor; AT2; MRX88; angiotensin II type-2 receptor; ATGR2;
Gene ID 186
mRNA Refseq NM_000686
Protein Refseq NP_000677
MIM 300034
UniProt ID P50052
Chromosome Location Xq22-q23
Pathway ACE Inhibitor Pathway, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem;
Function G-protein coupled receptor activity; angiotensin type II receptor activity; protein binding; receptor activity; receptor antagonist activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGTR2 Products

Required fields are marked with *

My Review for All AGTR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon