Recombinant Human AGTR2 protein, His/SUMO-tagged

• Cat.No.: AGTR2-33H
• Product Overview: Recombinant Human AGTR2(1-45aa) fused with His/SUMO tag was expressed in E. coli.

Specification

• Description: The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked mental retardation.
• Source: E. coli
• Species: Human
• Tag: His/SUMO
• Form: 20mM Tris-HCl based buffer,pH8.0
• Protein length: 1-45aa
• AA Sequence: MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigradefor up to one week.

Gene Information

• Gene Name: AGTR2 angiotensin II receptor, type 2 [ Homo sapiens ]
• Official Symbol: AGTR2
• Synonyms: AGTR2; angiotensin II receptor, type 2; angiotensin receptor 2; type-2 angiotensin II receptor; AT2; MRX88; angiotensin II type-2 receptor; ATGR2
• Gene ID: 186
• mRNA Refseq: NM_000686
• Protein Refseq: NP_000677
• MIM: 300034
• UniProt ID: P50052
• Chromosome Location: Xq22-q23
• Pathway: ACE Inhibitor Pathway, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem
• Function: G-protein coupled receptor activity; angiotensin type II receptor activity; protein binding; receptor activity; receptor antagonist activity; signal transducer activity