Recombinant Human AGXT2 Protein, GST-tagged
Cat.No. : | AGXT2-453H |
Product Overview : | Human AGXT2 partial ORF ( NP_114106, 415 a.a. - 514 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor. It is an important regulator of methylarginines and is involved in the control of blood pressure in kidney. Polymorphisms in this gene affect methylarginine and beta-aminoisobutyrate metabolism, and are associated with carotid atherosclerosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LLKFAKLRDEFEIVGDVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AGXT2 alanine--glyoxylate aminotransferase 2 [ Homo sapiens ] |
Official Symbol | AGXT2 |
Synonyms | AGXT2; alanine--glyoxylate aminotransferase 2; alanine glyoxylate aminotransferase 2; alanine--glyoxylate aminotransferase 2, mitochondrial; AGT2; beta ALAAT II; beta alanine pyruvate aminotransferase; beta-ALAAT II; beta-alanine-pyruvate aminotransferase; (R)-3-amino-2-methylpropionate--pyruvate transaminase; DAIBAT; |
Gene ID | 64902 |
mRNA Refseq | NM_031900 |
Protein Refseq | NP_114106 |
MIM | 612471 |
UniProt ID | Q9BYV1 |
◆ Recombinant Proteins | ||
Agxt2-1030M | Recombinant Mouse Agxt2 protein, His & T7-tagged | +Inquiry |
AGXT2-453H | Recombinant Human AGXT2 Protein, GST-tagged | +Inquiry |
AGXT2-0049H | Recombinant Human AGXT2 Protein (Cys259-Lys514), N-His-tagged | +Inquiry |
AGXT2-521H | Recombinant Human AGXT2 Protein, MYC/DDK-tagged | +Inquiry |
AGXT2-3423Z | Recombinant Zebrafish AGXT2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGXT2 Products
Required fields are marked with *
My Review for All AGXT2 Products
Required fields are marked with *
0
Inquiry Basket