Recombinant Human AHR
Cat.No. : | AHR-26266TH |
Product Overview : | Recombinant fragment corresponding to amino acids 721-820 of Human Aryl hydrocarbon Receptor, with a proprietary tag. Predicted MWt 36.63kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons. |
Molecular Weight : | 36.630kDa |
Tissue specificity : | Expressed in all tissues tested including blood, brain, heart, kidney, liver, lung, pancreas and skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN |
Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 PAC (PAS-associated C-terminal) domain.Contains 2 PAS (PER-ARNT-SIM) domains. |
Gene Name | AHR aryl hydrocarbon receptor [ Homo sapiens ] |
Official Symbol | AHR |
Synonyms | AHR; aryl hydrocarbon receptor; bHLHe76; |
Gene ID | 196 |
mRNA Refseq | NM_001621 |
Protein Refseq | NP_001612 |
MIM | 600253 |
Uniprot ID | P35869 |
Chromosome Location | 7p15 |
Pathway | Adipogenesis, organism-specific biosystem; |
Function | DNA binding; DNA binding; Hsp90 protein binding; ligand-dependent nuclear receptor activity; protein binding; |
◆ Recombinant Proteins | ||
Ahr-6846R | Recombinant Rat Ahr protein, His-tagged | +Inquiry |
AHR-603HF | Recombinant Full Length Human AHR Protein, GST-tagged | +Inquiry |
AHR-26266TH | Recombinant Human AHR | +Inquiry |
AHR-120H | Recombinant Human AHR protein, His-tagged | +Inquiry |
AHR-109H | Recombinant Human Aryl hydrocarbon receptor LBD/Hsp90 complex, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AHR-8962HCL | Recombinant Human AHR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AHR Products
Required fields are marked with *
My Review for All AHR Products
Required fields are marked with *
0
Inquiry Basket