Recombinant Human AHSG protein(141-280 aa), C-His-tagged

Cat.No. : AHSG-2529H
Product Overview : Recombinant Human AHSG protein(P02765)(141-280 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 141-280 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPS
Gene Name AHSG alpha-2-HS-glycoprotein [ Homo sapiens ]
Official Symbol AHSG
Synonyms AHSG; alpha-2-HS-glycoprotein; A2HS; FETUA; HSGA; fetuin-A; alpha-2-Z-globulin; ba-alpha-2-glycoprotein; AHS;
Gene ID 197
mRNA Refseq NM_001622
Protein Refseq NP_001613
MIM 138680
UniProt ID P02765

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AHSG Products

Required fields are marked with *

My Review for All AHSG Products

Required fields are marked with *

0
cart-icon
0
compare icon