Recombinant Human AHSG protein(141-280 aa), C-His-tagged
Cat.No. : | AHSG-2529H |
Product Overview : | Recombinant Human AHSG protein(P02765)(141-280 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 141-280 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPS |
Gene Name | AHSG alpha-2-HS-glycoprotein [ Homo sapiens ] |
Official Symbol | AHSG |
Synonyms | AHSG; alpha-2-HS-glycoprotein; A2HS; FETUA; HSGA; fetuin-A; alpha-2-Z-globulin; ba-alpha-2-glycoprotein; AHS; |
Gene ID | 197 |
mRNA Refseq | NM_001622 |
Protein Refseq | NP_001613 |
MIM | 138680 |
UniProt ID | P02765 |
◆ Recombinant Proteins | ||
Ahsg-705M | Active Recombinant Mouse Ahsg protein(Met1-Ile345), His-tagged | +Inquiry |
AHSG-704H | Recombinant Human AHSG protein, His-tagged | +Inquiry |
AHSG-0314H | Recombinant Human AHSG Protein (Ala19-Leu300), N-His-tagged | +Inquiry |
AHSG-166H | Recombinant Human AHSG Protein, His/GST-tagged | +Inquiry |
AHSG-202H | Recombinant Human AHSG protein, T7/His-tagged | +Inquiry |
◆ Native Proteins | ||
AHSG-1001H | Human Leucine-rich Alpha-2-glycoprotein 1 | +Inquiry |
AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AHSG-2957MCL | Recombinant Mouse AHSG cell lysate | +Inquiry |
AHSG-2958HCL | Recombinant Human AHSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AHSG Products
Required fields are marked with *
My Review for All AHSG Products
Required fields are marked with *
0
Inquiry Basket