Recombinant Human AHSG protein(141-280 aa), C-His-tagged
| Cat.No. : | AHSG-2529H |
| Product Overview : | Recombinant Human AHSG protein(P02765)(141-280 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 141-280 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPS |
| Gene Name | AHSG alpha-2-HS-glycoprotein [ Homo sapiens ] |
| Official Symbol | AHSG |
| Synonyms | AHSG; alpha-2-HS-glycoprotein; A2HS; FETUA; HSGA; fetuin-A; alpha-2-Z-globulin; ba-alpha-2-glycoprotein; AHS; |
| Gene ID | 197 |
| mRNA Refseq | NM_001622 |
| Protein Refseq | NP_001613 |
| MIM | 138680 |
| UniProt ID | P02765 |
| ◆ Recombinant Proteins | ||
| AHSG-0314H | Recombinant Human AHSG Protein (Ala19-Leu300), N-His-tagged | +Inquiry |
| Ahsg-102G | Recombinant Guinea pig Ahsg Protein, His-tagged | +Inquiry |
| aHSG-3325R | Recombinant Rat aHSG, His-tagged | +Inquiry |
| AHSG-2529H | Recombinant Human AHSG protein(141-280 aa), C-His-tagged | +Inquiry |
| Ahsg-7155M | Recombinant Mouse Ahsg Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
| AHSG-1001H | Human Leucine-rich Alpha-2-glycoprotein 1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AHSG-2957MCL | Recombinant Mouse AHSG cell lysate | +Inquiry |
| AHSG-2958HCL | Recombinant Human AHSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AHSG Products
Required fields are marked with *
My Review for All AHSG Products
Required fields are marked with *



