Recombinant Human AHSG Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | AHSG-2173H |
| Product Overview : | AHSG MS Standard C13 and N15-labeled recombinant protein (NP_001613) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness. |
| Molecular Mass : | 39.3 kDa |
| AA Sequence : | MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | AHSG alpha-2-HS-glycoprotein [ Homo sapiens (human) ] |
| Official Symbol | AHSG |
| Synonyms | AHSG; alpha-2-HS-glycoprotein; A2HS; FETUA; HSGA; fetuin-A; alpha-2-Z-globulin; ba-alpha-2-glycoprotein; AHS; |
| Gene ID | 197 |
| mRNA Refseq | NM_001622 |
| Protein Refseq | NP_001613 |
| MIM | 138680 |
| UniProt ID | P02765 |
| ◆ Recombinant Proteins | ||
| AHSG-103P | Recombinant Pig AHSG Protein, His-tagged | +Inquiry |
| Ahsg-92M | Recombinant Mouse Ahsg, His-tagged | +Inquiry |
| AHSG-166H | Recombinant Human AHSG Protein, His/GST-tagged | +Inquiry |
| Ahsg-168R | Recombinant Rat Ahsg Protein, His-tagged | +Inquiry |
| AHSG-0312H | Recombinant Human AHSG Protein (Ala19-Val367), N-His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
| AHSG-1001H | Human Leucine-rich Alpha-2-glycoprotein 1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AHSG-2958HCL | Recombinant Human AHSG cell lysate | +Inquiry |
| AHSG-2957MCL | Recombinant Mouse AHSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AHSG Products
Required fields are marked with *
My Review for All AHSG Products
Required fields are marked with *
