Recombinant Human AKAP7 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: AKAP7-101H
• Product Overview: AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_004833) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.
• Molecular Mass: 8.8 kDa
• AA Sequence: MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: AKAP7 A-kinase anchoring protein 7 [ Homo sapiens (human) ]
• Official Symbol: AKAP7
• Synonyms: AKAP7; A-kinase anchoring protein 7; AKAP15; AKAP18; A-kinase anchoring protein 7; A kinase (PRKA) anchor protein 7; A-kinase anchor protein 18 kDa; A-kinase anchor protein 9 kDa; AKAP 18
• Gene ID: 9465
• mRNA Refseq: NM_004842
• Protein Refseq: NP_004833
• MIM: 604693
• UniProt ID: O43687