Recombinant Human AKAP8 protein, GST-tagged
| Cat.No. : | AKAP8-3446H |
| Product Overview : | Recombinant Human AKAP8 protein(501-692 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 501-692 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | SVDHNHNRRLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYLKGEDPFTSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAADAEVEQTDAESKDAVPTE |
| Gene Name | AKAP8 A kinase (PRKA) anchor protein 8 [ Homo sapiens ] |
| Official Symbol | AKAP8 |
| Synonyms | AKAP8; A kinase (PRKA) anchor protein 8; A-kinase anchor protein 8; A kinase anchor protein; 95kDa; AKAP95; DKFZp586B1222; A-kinase anchor protein, 95kDa; AKAP-8; AKAP 95; AKAP-95; |
| Gene ID | 10270 |
| mRNA Refseq | NM_005858 |
| Protein Refseq | NP_005849 |
| MIM | 604692 |
| UniProt ID | O43823 |
| ◆ Recombinant Proteins | ||
| AKAP8-633H | Recombinant Human AKAP8 protein, His&Myc-tagged | +Inquiry |
| AKAP8-3032H | Recombinant Human AKAP8, His-tagged | +Inquiry |
| AKAP8-3446H | Recombinant Human AKAP8 protein, GST-tagged | +Inquiry |
| AKAP8-403H | Recombinant Human AKAP8 Protein, GST-tagged | +Inquiry |
| AKAP8-1354HF | Recombinant Full Length Human AKAP8 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AKAP8-324HKCL | Human AKAP8 Knockdown Cell Lysate | +Inquiry |
| AKAP8-46HCL | Recombinant Human AKAP8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKAP8 Products
Required fields are marked with *
My Review for All AKAP8 Products
Required fields are marked with *



