Recombinant Human AKAP8 protein, GST-tagged
Cat.No. : | AKAP8-3446H |
Product Overview : | Recombinant Human AKAP8 protein(501-692 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 501-692 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | SVDHNHNRRLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYLKGEDPFTSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAADAEVEQTDAESKDAVPTE |
Gene Name | AKAP8 A kinase (PRKA) anchor protein 8 [ Homo sapiens ] |
Official Symbol | AKAP8 |
Synonyms | AKAP8; A kinase (PRKA) anchor protein 8; A-kinase anchor protein 8; A kinase anchor protein; 95kDa; AKAP95; DKFZp586B1222; A-kinase anchor protein, 95kDa; AKAP-8; AKAP 95; AKAP-95; |
Gene ID | 10270 |
mRNA Refseq | NM_005858 |
Protein Refseq | NP_005849 |
MIM | 604692 |
UniProt ID | O43823 |
◆ Recombinant Proteins | ||
BCL2-76H | Recombinant Human BCL2 protein | +Inquiry |
BCL2-5298H | Recombinant Human B-cell CLL/lymphoma 2, GST-tagged | +Inquiry |
BCL2-143H | Recombinant Human BCL2 Protein, GST-tagged | +Inquiry |
BCL2-0580H | Recombinant Human BCL2 Protein (Met1-Asp211), C-His-tagged | +Inquiry |
AKAP9-9464H | Recombinant Human AKAP9 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL2 Products
Required fields are marked with *
My Review for All BCL2 Products
Required fields are marked with *
0
Inquiry Basket