Recombinant Human ALAD Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ALAD-6108H |
Product Overview : | ALAD MS Standard C13 and N15-labeled recombinant protein (NP_000022) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. |
Molecular Mass : | 37.23 kDa |
AA Sequence : | MPLCPLAHAMQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKRLEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEESGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ALAD aminolevulinate dehydratase [ Homo sapiens (human) ] |
Official Symbol | ALAD |
Synonyms | ALAD; aminolevulinate dehydratase; aminolevulinate, delta, dehydratase; delta-aminolevulinic acid dehydratase; ALADH; PBGS; porphobilinogen synthase; aminolevulinate, delta-, dehydratase; MGC5057; |
Gene ID | 210 |
mRNA Refseq | NM_000031 |
Protein Refseq | NP_000022 |
MIM | 125270 |
UniProt ID | P13716 |
◆ Recombinant Proteins | ||
ALAD-42C | Recombinant Cynomolgus Monkey ALAD Protein, His (Fc)-Avi-tagged | +Inquiry |
ALAD-512H | Recombinant Human ALAD Protein, His-tagged | +Inquiry |
ALAD-5496C | Recombinant Chicken ALAD | +Inquiry |
ALAD-265R | Recombinant Rat ALAD Protein, His (Fc)-Avi-tagged | +Inquiry |
ALAD-428H | Recombinant Human ALAD Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALAD-54HCL | Recombinant Human ALAD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALAD Products
Required fields are marked with *
My Review for All ALAD Products
Required fields are marked with *
0
Inquiry Basket