Recombinant Human ALDH1L1 Protein, GST-tagged

Cat.No. : ALDH1L1-442H
Product Overview : Human ALDH1L1 partial ORF ( NP_036322, 803 a.a. - 902 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, nicotinamide adenine dinucleotide phosphate (NADP+), and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family. Loss of function or expression of this gene is associated with decreased apoptosis, increased cell motility, and cancer progression. There is an antisense transcript that overlaps on the opposite strand with this gene locus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012]
Molecular Mass : 36.74 kDa
AA Sequence : EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ALDH1L1 aldehyde dehydrogenase 1 family, member L1 [ Homo sapiens ]
Official Symbol ALDH1L1
Synonyms ALDH1L1; aldehyde dehydrogenase 1 family, member L1; formyltetrahydrofolate dehydrogenase , FTHFD; cytosolic 10-formyltetrahydrofolate dehydrogenase; 10 fTHF; cytosolic 10 formyltetrahydrofolate dehydrogenase; 10-FTHFDH; formyltetrahydrofolate dehydrogenase; 10-formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase family 1 member L1; FDH; FTHFD; 10-fTHF; DKFZp781N0997;
Gene ID 10840
mRNA Refseq NM_012190
Protein Refseq NP_036322
MIM 600249
UniProt ID O75891

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALDH1L1 Products

Required fields are marked with *

My Review for All ALDH1L1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon