Recombinant Human ALDH1L1 Protein, GST-tagged
Cat.No. : | ALDH1L1-442H |
Product Overview : | Human ALDH1L1 partial ORF ( NP_036322, 803 a.a. - 902 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, nicotinamide adenine dinucleotide phosphate (NADP+), and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family. Loss of function or expression of this gene is associated with decreased apoptosis, increased cell motility, and cancer progression. There is an antisense transcript that overlaps on the opposite strand with this gene locus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALDH1L1 aldehyde dehydrogenase 1 family, member L1 [ Homo sapiens ] |
Official Symbol | ALDH1L1 |
Synonyms | ALDH1L1; aldehyde dehydrogenase 1 family, member L1; formyltetrahydrofolate dehydrogenase , FTHFD; cytosolic 10-formyltetrahydrofolate dehydrogenase; 10 fTHF; cytosolic 10 formyltetrahydrofolate dehydrogenase; 10-FTHFDH; formyltetrahydrofolate dehydrogenase; 10-formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase family 1 member L1; FDH; FTHFD; 10-fTHF; DKFZp781N0997; |
Gene ID | 10840 |
mRNA Refseq | NM_012190 |
Protein Refseq | NP_036322 |
MIM | 600249 |
UniProt ID | O75891 |
◆ Recombinant Proteins | ||
Aldh1l1-117M | Recombinant Mouse Aldh1l1 Protein, His-tagged | +Inquiry |
ALDH1L1-491H | Recombinant Human Aldehyde Dehydrogenase 1 Family, Member L1, His-tagged | +Inquiry |
ALDH1L1-1509HFL | Recombinant Full Length Human ALDH1L1 Protein, C-Flag-tagged | +Inquiry |
Aldh1l1-344M | Recombinant Mouse Aldh1l1 Protein, MYC/DDK-tagged | +Inquiry |
ALDH1L1-9554H | Recombinant Human ALDH1L1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH1L1-17HCL | Recombinant Human ALDH1L1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALDH1L1 Products
Required fields are marked with *
My Review for All ALDH1L1 Products
Required fields are marked with *
0
Inquiry Basket