Recombinant Human ALG12 Protein, GST-tagged

Cat.No. : ALG12-461H
Product Overview : Human ALG12 partial ORF ( NP_077010, 369 a.a. - 425 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig)characterized by abnormal N-glycosylation. [provided by RefSeq, Jul 2008]
Molecular Mass : 32.01 kDa
AA Sequence : NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ALG12 asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol ALG12
Synonyms ALG12; asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 12 homolog (yeast, alpha 1,6 mannosyltransferase); dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase; ECM39; membrane protein SB87; mannosyltransferase ALG12 homolog; asparagine-linked glycosylation protein 12 homolog; dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase; dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase; asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase); asparagine-linked glycosylation 12 homolog (S. cerevisiae, alpha-1,6-mannosyltransferase); CDG1G; hALG12; PP14673; MGC3136; MGC111358;
Gene ID 79087
mRNA Refseq NM_024105
Protein Refseq NP_077010
MIM 607144
UniProt ID Q9BV10

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALG12 Products

Required fields are marked with *

My Review for All ALG12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon