Recombinant Human ALG12 Protein, GST-tagged
Cat.No. : | ALG12-461H |
Product Overview : | Human ALG12 partial ORF ( NP_077010, 369 a.a. - 425 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig)characterized by abnormal N-glycosylation. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 32.01 kDa |
AA Sequence : | NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALG12 asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ALG12 |
Synonyms | ALG12; asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 12 homolog (yeast, alpha 1,6 mannosyltransferase); dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase; ECM39; membrane protein SB87; mannosyltransferase ALG12 homolog; asparagine-linked glycosylation protein 12 homolog; dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase; dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase; asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase); asparagine-linked glycosylation 12 homolog (S. cerevisiae, alpha-1,6-mannosyltransferase); CDG1G; hALG12; PP14673; MGC3136; MGC111358; |
Gene ID | 79087 |
mRNA Refseq | NM_024105 |
Protein Refseq | NP_077010 |
MIM | 607144 |
UniProt ID | Q9BV10 |
◆ Recombinant Proteins | ||
ALG12-3334C | Recombinant Chicken ALG12 | +Inquiry |
ALG12-5710Z | Recombinant Zebrafish ALG12 | +Inquiry |
ALG12-461H | Recombinant Human ALG12 Protein, GST-tagged | +Inquiry |
ALG12-9572H | Recombinant Human ALG12, GST-tagged | +Inquiry |
ALG12-6543H | Recombinant Human ALG12 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALG12 Products
Required fields are marked with *
My Review for All ALG12 Products
Required fields are marked with *
0
Inquiry Basket