Recombinant Human ALG12 protein, His-tagged

• Cat.No.: ALG12-6543H
• Product Overview: Recombinant Human ALG12 protein(375-488 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 375-488 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: AMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTGMLAYTHILMEAAPGLLALYRDTHRVLASVVGTTGVSLNLTQLPPFNVHLQTKLVLLERLPRPS

Gene Information

• Gene Name: ALG12 asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ALG12
• Synonyms: ALG12; asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 12 homolog (yeast, alpha 1,6 mannosyltransferase); dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase; ECM39; membrane protein SB87; mannosyltransferase ALG12 homolog; asparagine-linked glycosylation protein 12 homolog; dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase; dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase; asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase); asparagine-linked glycosylation 12 homolog (S. cerevisiae, alpha-1,6-mannosyltransferase); CDG1G; hALG12; PP14673; MGC3136; MGC111358
• Gene ID: 79087
• mRNA Refseq: NM_024105
• Protein Refseq: NP_077010
• MIM: 607144
• UniProt ID: Q9BV10