Recombinant Human ALG6 protein, His-tagged

• Cat.No.: ALG6-9655H
• Product Overview: Recombinant Human ALG6 protein(14-125 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 14-125 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: GLTVRWTVSLNSYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLIYI

Gene Information

• Gene Name: ALG6 asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ALG6
• Synonyms: ALG6; asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 6 homolog (yeast, alpha 1,3 glucosyltransferase); dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase; asparagine-linked glycosylation protein 6 homolog; Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase; dolichyl-P-Glc:Man9GlcNAc2-PP-dolichylglucosyltransferase; dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase; dol-P-Glc:Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase; asparagine-linked glycosylation 6 homolog (yeast, alpha-1,3-glucosyltransferase); asparagine-linked glycosylation 6 homolog (S. cerevisiae, alpha-1,3-glucosyltransferase); CDG1C
• Gene ID: 29929
• mRNA Refseq: NM_013339
• Protein Refseq: NP_037471
• MIM: 604566
• UniProt ID: Q9Y672