Recombinant Human ALG6 protein, His-tagged
Cat.No. : | ALG6-9655H |
Product Overview : | Recombinant Human ALG6 protein(14-125 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 14-125 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | GLTVRWTVSLNSYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLIYI |
Gene Name | ALG6 asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ALG6 |
Synonyms | ALG6; asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 6 homolog (yeast, alpha 1,3 glucosyltransferase); dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase; asparagine-linked glycosylation protein 6 homolog; Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase; dolichyl-P-Glc:Man9GlcNAc2-PP-dolichylglucosyltransferase; dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase; dol-P-Glc:Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase; asparagine-linked glycosylation 6 homolog (yeast, alpha-1,3-glucosyltransferase); asparagine-linked glycosylation 6 homolog (S. cerevisiae, alpha-1,3-glucosyltransferase); CDG1C; |
Gene ID | 29929 |
mRNA Refseq | NM_013339 |
Protein Refseq | NP_037471 |
MIM | 604566 |
UniProt ID | Q9Y672 |
◆ Recombinant Proteins | ||
ALG6-630R | Recombinant Rat ALG6 Protein | +Inquiry |
ALG6-1117Z | Recombinant Zebrafish ALG6 | +Inquiry |
ALG6-469M | Recombinant Mouse ALG6 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALG6-9655H | Recombinant Human ALG6 protein, His-tagged | +Inquiry |
ALG6-286R | Recombinant Rat ALG6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALG6 Products
Required fields are marked with *
My Review for All ALG6 Products
Required fields are marked with *