Recombinant Human ALG9 protein, His-tagged

• Cat.No.: ALG9-3812H
• Product Overview: Recombinant Human ALG9 protein(440-618 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 440-618 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: FRGYHGPLDLYPEFYRIATDPTIHTVPEGRPVNVCVGKEWYRFPSSFLLPDNWQLQFIPSEFRGQLPKPFAEGPLATRIVPTDMNDQNLEEPSRYIDISKCHYLVDLDTMRETPREPKYSSNKEEWISLAYRPFLDASRSSKLLRAFYVPFLSDQYTVYVNYTILKPRKAKQIRKKSGG
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ALG9 asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ALG9
• Synonyms: ALG9; asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 9 homolog (yeast, alpha 1,2 mannosyltransferase) , asparagine linked glycosylation 9, alpha 1,2 mannosyltransferase homolog (S. cerevisiae, alpha 1,2 mannosyltransferase) , DIBD1, disrupted in bipolar affective disorder 1; alpha-1,2-mannosyltransferase ALG9; disrupted in bipolar disorder protein 1; disrupted in bipolar affective disorder 1; asparagine-linked glycosylation protein 9 homolog; dol-P-Man:Man(6)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase; dol-P-Man:Man(8)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase; loss of heterozygosity, 11, chromosomal region 1 gene J product; asparagine-linked glycosylation 9 homolog (yeast, alpha- 1,2-mannosyltransferase); asparagine-linked glycosylation 9 homolog (S. cerevisiae, alpha- 1,2-mannosyltransferase); CDG1L; DIBD1; LOH11CR1J; FLJ21845; DKFZp586M2420
• Gene ID: 79796
• mRNA Refseq: NM_024740
• Protein Refseq: NP_079016
• MIM: 606941
• UniProt ID: Q9H6U8