Recombinant Human ALG9 protein, His-tagged

Cat.No. : ALG9-3812H
Product Overview : Recombinant Human ALG9 protein(440-618 aa), fused to His tag, was expressed in E. coli.
Availability December 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 440-618 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : FRGYHGPLDLYPEFYRIATDPTIHTVPEGRPVNVCVGKEWYRFPSSFLLPDNWQLQFIPSEFRGQLPKPFAEGPLATRIVPTDMNDQNLEEPSRYIDISKCHYLVDLDTMRETPREPKYSSNKEEWISLAYRPFLDASRSSKLLRAFYVPFLSDQYTVYVNYTILKPRKAKQIRKKSGG
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ALG9 asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol ALG9
Synonyms ALG9; asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 9 homolog (yeast, alpha 1,2 mannosyltransferase) , asparagine linked glycosylation 9, alpha 1,2 mannosyltransferase homolog (S. cerevisiae, alpha 1,2 mannosyltransferase) , DIBD1, disrupted in bipolar affective disorder 1; alpha-1,2-mannosyltransferase ALG9; disrupted in bipolar disorder protein 1; disrupted in bipolar affective disorder 1; asparagine-linked glycosylation protein 9 homolog; dol-P-Man:Man(6)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase; dol-P-Man:Man(8)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase; loss of heterozygosity, 11, chromosomal region 1 gene J product; asparagine-linked glycosylation 9 homolog (yeast, alpha- 1,2-mannosyltransferase); asparagine-linked glycosylation 9 homolog (S. cerevisiae, alpha- 1,2-mannosyltransferase); CDG1L; DIBD1; LOH11CR1J; FLJ21845; DKFZp586M2420;
Gene ID 79796
mRNA Refseq NM_024740
Protein Refseq NP_079016
MIM 606941
UniProt ID Q9H6U8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALG9 Products

Required fields are marked with *

My Review for All ALG9 Products

Required fields are marked with *

0
cart-icon
0
compare icon