Recombinant Human ALG9 protein, His-tagged
| Cat.No. : | ALG9-3812H |
| Product Overview : | Recombinant Human ALG9 protein(440-618 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 440-618 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | FRGYHGPLDLYPEFYRIATDPTIHTVPEGRPVNVCVGKEWYRFPSSFLLPDNWQLQFIPSEFRGQLPKPFAEGPLATRIVPTDMNDQNLEEPSRYIDISKCHYLVDLDTMRETPREPKYSSNKEEWISLAYRPFLDASRSSKLLRAFYVPFLSDQYTVYVNYTILKPRKAKQIRKKSGG |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ALG9 asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | ALG9 |
| Synonyms | ALG9; asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 9 homolog (yeast, alpha 1,2 mannosyltransferase) , asparagine linked glycosylation 9, alpha 1,2 mannosyltransferase homolog (S. cerevisiae, alpha 1,2 mannosyltransferase) , DIBD1, disrupted in bipolar affective disorder 1; alpha-1,2-mannosyltransferase ALG9; disrupted in bipolar disorder protein 1; disrupted in bipolar affective disorder 1; asparagine-linked glycosylation protein 9 homolog; dol-P-Man:Man(6)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase; dol-P-Man:Man(8)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase; loss of heterozygosity, 11, chromosomal region 1 gene J product; asparagine-linked glycosylation 9 homolog (yeast, alpha- 1,2-mannosyltransferase); asparagine-linked glycosylation 9 homolog (S. cerevisiae, alpha- 1,2-mannosyltransferase); CDG1L; DIBD1; LOH11CR1J; FLJ21845; DKFZp586M2420; |
| Gene ID | 79796 |
| mRNA Refseq | NM_024740 |
| Protein Refseq | NP_079016 |
| MIM | 606941 |
| UniProt ID | Q9H6U8 |
| ◆ Recombinant Proteins | ||
| ALG9-468H | Recombinant Human ALG9 Protein, GST-tagged | +Inquiry |
| ALG9-1551M | Recombinant Mouse ALG9 Protein | +Inquiry |
| ALG9-3812H | Recombinant Human ALG9 protein, His-tagged | +Inquiry |
| ALG9-10898Z | Recombinant Zebrafish ALG9 | +Inquiry |
| ALG9-1440HF | Recombinant Full Length Human ALG9 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ALG9-8904HCL | Recombinant Human ALG9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALG9 Products
Required fields are marked with *
My Review for All ALG9 Products
Required fields are marked with *
