"ALPP" Related Products

Expand
Expand

Recombinant Human ALPP protein, T7/His-tagged

Cat.No.: ALPP-221H
Product Overview: Recombinant human ALPP cDNA (23-506aa, derived from BC009647) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGV STVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQC NTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDI DVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEP GDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTS EEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQ QSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPPAGTTD
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro ALPP mediated Insulin-like growth factor (IGF) pathway regulation study in stem cell proliferation by coating this protein as matrix protein or use it as soluble factor.2. May be used for protein-protein interaction mapping.3. As enzymatic substrate for various proteases.4. Potential biomarker protein for tumor diagnosis, such as ovarian cancer, et al.5. As immunogen for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: ALPP alkaline phosphatase, placental [ Homo sapiens ]
Official Symbol: ALPP
Synonyms: ALPP; alkaline phosphatase, placental; alkaline phosphatase, placental (Regan isozyme); alkaline phosphatase, placental type; Regan isozyme; PLAP-1; glycerophosphatase; alkaline phosphomonoesterase; placental alkaline phosphatase 1; alkaline phosphatase Regan isozyme; ALP; PALP; PLAP; FLJ61142;
Gene ID: 250
mRNA Refseq: NM_001632
Protein Refseq: NP_001623
MIM: 171800
UniProt ID: P05187
Chromosome Location: 2q37.1
Pathway: Folate biosynthesis, organism-specific biosystem; Folate biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function: alkaline phosphatase activity; alkaline phosphatase activity; hydrolase activity; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.