Recombinant Full Length Human Alkaline Phosphatase, Placental Type(Alpp) Protein, His-Tagged
Cat.No. : | RFL-27321HF |
Product Overview : | Recombinant Full Length Human Alkaline phosphatase, placental type(ALPP) Protein (P05187) (23-506aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-506) |
Form : | Lyophilized powder |
AA Sequence : | IIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKK DKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQ CNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQ EGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAK RQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLS RNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSH VFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYR QQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPPA GTTD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ALPP |
Synonyms | ALPP; PLAP; Alkaline phosphatase, placental type; Alkaline phosphatase Regan isozyme; Placental alkaline phosphatase 1; PLAP-1 |
UniProt ID | P05187 |
◆ Recombinant Proteins | ||
ALPP-302H | Recombinant Human ALPP Protein, His tagged | +Inquiry |
ALPP-0309H | Recombinant Human ALPP Protein (Ile23-Asp506), C-His-tagged | +Inquiry |
RFL-27321HF | Recombinant Full Length Human Alkaline Phosphatase, Placental Type(Alpp) Protein, His-Tagged | +Inquiry |
ALPP-1345C | Recombinant Cynomolgus ALPP protein, His-tagged | +Inquiry |
ALPP-67H | Recombinant Human ALPP Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ALPP-8005H | Native Human Placental Alkaline Phosphatase | +Inquiry |
ALPP-8347H | Native Human ALPP | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALPP-8893HCL | Recombinant Human ALPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALPP Products
Required fields are marked with *
My Review for All ALPP Products
Required fields are marked with *
0
Inquiry Basket