Recombinant Human AMY1A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | AMY1A-2967H |
Product Overview : | AMY1A MS Standard C13 and N15-labeled recombinant protein (NP_004029) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. Alternative splicing results in multiple transcript variants encoding the same protein. |
Molecular Mass : | 57.8 kDa |
AA Sequence : | MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | AMY1A amylase alpha 1A [ Homo sapiens (human) ] |
Official Symbol | AMY1A |
Synonyms | AMY1A; amylase, alpha 1A (salivary); AMY1, amylase, alpha 1A; salivary; alpha-amylase 1; glycogenase; salivary alpha-amylase; salivary amylase alpha 1A; amylase, salivary, alpha-1A; 1,4-alpha-D-glucan glucanohydrolase 1; AMY1; AMY1B; AMY1C; |
Gene ID | 276 |
mRNA Refseq | NM_004038 |
Protein Refseq | NP_004029 |
MIM | 104700 |
UniProt ID | P04745 |
◆ Recombinant Proteins | ||
AMY1A-336H | Recombinant Human AMY1A Protein, His (Fc)-Avi-tagged | +Inquiry |
AMY1A-2967H | Recombinant Human AMY1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AMY1A-7027H | Recombinant Human AMY1A protein, His-tagged | +Inquiry |
AMY1A-0538H | Recombinant Human AMY1A Protein (Ala15-Leu511), His-tagged | +Inquiry |
AMY1A-1118C | Recombinant Chicken AMY1A | +Inquiry |
◆ Native Proteins | ||
AMY1A-5329H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
AMY1A-8023H | Native Human Salivary Amylase (Alpha) | +Inquiry |
AMY1A-8022H | Native Human Salivary Amylase | +Inquiry |
AMY1A-5313H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMY1A Products
Required fields are marked with *
My Review for All AMY1A Products
Required fields are marked with *